DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reepl1 and yop1

DIOPT Version :10

Sequence 1:NP_572730.1 Gene:Reepl1 / 32103 FlyBaseID:FBgn0030313 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_588478.1 Gene:yop1 / 2539171 PomBaseID:SPCC830.08C Length:182 Species:Schizosaccharomyces pombe


Alignment Length:103 Identity:26/103 - (25%)
Similarity:51/103 - (49%) Gaps:10/103 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IYAIVI------HILSLLVGCFYPAFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGL 60
            |||:.:      .:|:.|:....|||.|...:::.| ..:|.: ||.|::........:|::..:
pombe    45 IYALFLFLNWGGFLLTNLLAFAMPAFFSINAIETTN-KADDTQ-WLTYYLVTSFLNVIEYWSQLI 107

  Fly    61 LAFIPLLSEFKVLLLFWM-LPSVGGGSEVIYEEFLRSF 97
            |.::|:....|.:.|.|: ||...|.: :||...:|.:
pombe   108 LYYVPVYWLLKAIFLIWLALPKFNGAT-IIYRHLIRPY 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reepl1NP_572730.1 TB2_DP1_HVA22 19..97 CDD:460820 21/78 (27%)
yop1NP_588478.1 YOP1 3..182 CDD:227385 26/103 (25%)

Return to query results.
Submit another query.