DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reepl1 and F56B3.6

DIOPT Version :10

Sequence 1:NP_572730.1 Gene:Reepl1 / 32103 FlyBaseID:FBgn0030313 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_499990.1 Gene:F56B3.6 / 176906 WormBaseID:WBGene00018930 Length:205 Species:Caenorhabditis elegans


Alignment Length:91 Identity:27/91 - (29%)
Similarity:45/91 - (49%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIYAIVIHILSLLVGCFYPAFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGLLAFIP 65
            :::..|..:|..|:|..||.:||.|.::|.  ..:|...|||||..:.|....|:|:..:|::.|
 Worm    94 LVFGSVARLLCNLIGFGYPTYASVKAIRSP--GGDDDTVWLIYWTCFAVLYLVDFFSEAILSWFP 156

  Fly    66 LLSEFKVLLLFWMLPSVGGGSEVIYE 91
            .....|...|.::......||.:.||
 Worm   157 FYYIAKACFLVYLYLPQTQGSVMFYE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reepl1NP_572730.1 TB2_DP1_HVA22 19..97 CDD:460820 22/73 (30%)
F56B3.6NP_499990.1 TB2_DP1_HVA22 112..188 CDD:460820 22/73 (30%)

Return to query results.
Submit another query.