DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11699 and Tmem242

DIOPT Version :9

Sequence 1:NP_001303568.1 Gene:CG11699 / 32101 FlyBaseID:FBgn0030311 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_081733.3 Gene:Tmem242 / 70544 MGIID:1917794 Length:140 Species:Mus musculus


Alignment Length:131 Identity:45/131 - (34%)
Similarity:66/131 - (50%) Gaps:6/131 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DAVAAEKERKFRIQAAAFLGLVGGVSALFGFSRTLATAKKTDSKVLQQAGTRQGMILMDEGATLA 73
            :|..:..:|.|.::...|||.......|.||..||:.|||...:...: ||.....|.:.|::||
Mouse    15 EAPGSPDDRLFLVKGGIFLGSAAAAGMLAGFVTTLSLAKKKSPEWFNK-GTMATAALPESGSSLA 78

  Fly    74 LRALGWGTLYAVMGTGAFCYGFWKLSGAKDFQEFRLKMGNALPRITKDEPPASRTDFESLTDLMK 138
            |||||||:|||..|.|...:..||..|....::||.||.:..|.|.|:...|     |...:::|
Mouse    79 LRALGWGSLYAWCGVGVISFAVWKALGVHSMKDFRSKMQSIFPPIPKNHESA-----EEWEEVLK 138

  Fly   139 Y 139
            :
Mouse   139 W 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11699NP_001303568.1 DUF1358 3..118 CDD:284504 40/108 (37%)
Tmem242NP_081733.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 1/4 (25%)
DUF1358 10..123 CDD:284504 40/108 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833719
Domainoid 1 1.000 76 1.000 Domainoid score I8993
eggNOG 1 0.900 - - E1_2BY00
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44020
Inparanoid 1 1.050 78 1.000 Inparanoid score I5227
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47459
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008285
OrthoInspector 1 1.000 - - oto93518
orthoMCL 1 0.900 - - OOG6_107908
Panther 1 1.100 - - LDO PTHR13141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5745
SonicParanoid 1 1.000 - - X6265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.