DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11699 and tmem242

DIOPT Version :9

Sequence 1:NP_001303568.1 Gene:CG11699 / 32101 FlyBaseID:FBgn0030311 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001153486.1 Gene:tmem242 / 569632 ZFINID:ZDB-GENE-040724-146 Length:142 Species:Danio rerio


Alignment Length:144 Identity:52/144 - (36%)
Similarity:67/144 - (46%) Gaps:15/144 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEAGTSADAVAAEKERKFRIQAAAFLGLVGGVSALFGFSRTLATAKKTDSKVLQQAGTRQGMILM 66
            |.:|..:|.|  |.::...|:..|||..|.....:.||..|||.|||.......: |......:.
Zfish     7 SASGAVSDIV--EDDKSHLIKGGAFLATVATAGMIAGFGATLAVAKKKSPDWFNK-GIIGSAAVP 68

  Fly    67 DEGATLALRALGWGTLYAVMGTGAFCYGFWKLSGAKDFQEFRLKMGNALPRITKDE-PPASRTDF 130
            :.||:|||||||||:|||..|.|......||..|....||||.||.:..|.|.|:| ..|:...|
Zfish    69 ESGASLALRALGWGSLYAWCGVGLLSLTIWKAMGVHSLQEFRQKMQSIFPAIPKNEDAQANSVPF 133

  Fly   131 ESLTDLMKYLAAWN 144
            :           ||
Zfish   134 D-----------WN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11699NP_001303568.1 DUF1358 3..118 CDD:284504 44/114 (39%)
tmem242NP_001153486.1 DUF1358 6..120 CDD:284504 45/115 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576438
Domainoid 1 1.000 74 1.000 Domainoid score I9163
eggNOG 1 0.900 - - E1_2BY00
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44020
Inparanoid 1 1.050 79 1.000 Inparanoid score I5231
OMA 1 1.010 - - QHG47459
OrthoDB 1 1.010 - - D1365284at2759
OrthoFinder 1 1.000 - - FOG0008285
OrthoInspector 1 1.000 - - oto41673
orthoMCL 1 0.900 - - OOG6_107908
Panther 1 1.100 - - LDO PTHR13141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5745
SonicParanoid 1 1.000 - - X6265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.