DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11699 and tmem242

DIOPT Version :9

Sequence 1:NP_001303568.1 Gene:CG11699 / 32101 FlyBaseID:FBgn0030311 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001016041.1 Gene:tmem242 / 548795 XenbaseID:XB-GENE-948363 Length:144 Species:Xenopus tropicalis


Alignment Length:143 Identity:51/143 - (35%)
Similarity:75/143 - (52%) Gaps:9/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEAGTSADAVAAEK------ERKFRIQAAAFLGLVGGVSALFGFSRTLATAKKTDSKVLQQAGTR 60
            ::...:|.::|:|.      |:.|.|:...|||:|.....|.||..||:.|||.......: |..
 Frog     3 TQGALNAQSLASETGPGRAGEKLFLIKGGIFLGMVATAGMLAGFGTTLSLAKKRSPNWFNK-GVA 66

  Fly    61 QGMILMDEGATLALRALGWGTLYAVMGTGAFCYGFWKLSGAKDFQEFRLKMGNALPRITKDEPPA 125
            ....|.:.|::|||||||||:|||..|.|...:..||..|....:|||.||.:..|.::|. |..
 Frog    67 ATATLPESGSSLALRALGWGSLYAWCGVGLISFAVWKALGVHSLKEFREKMQSIFPSVSKG-PEQ 130

  Fly   126 SRTDFESLTDLMK 138
            :.:|| |..|::|
 Frog   131 ATSDF-SFEDILK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11699NP_001303568.1 DUF1358 3..118 CDD:284504 44/120 (37%)
tmem242NP_001016041.1 DUF1358 10..124 CDD:369206 43/114 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9999
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44020
Inparanoid 1 1.050 65 1.000 Inparanoid score I5187
OMA 1 1.010 - - QHG47459
OrthoDB 1 1.010 - - D1365284at2759
OrthoFinder 1 1.000 - - FOG0008285
OrthoInspector 1 1.000 - - oto103752
Panther 1 1.100 - - LDO PTHR13141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5745
SonicParanoid 1 1.000 - - X6265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.