DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11699 and Tmem242

DIOPT Version :9

Sequence 1:NP_001303568.1 Gene:CG11699 / 32101 FlyBaseID:FBgn0030311 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001138332.1 Gene:Tmem242 / 292228 RGDID:1307262 Length:140 Species:Rattus norvegicus


Alignment Length:130 Identity:47/130 - (36%)
Similarity:67/130 - (51%) Gaps:3/130 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEAGTSADAVAAEKERKFRIQAAAFLGLVGGVSALFGFSRTLATAKKTDSKVLQQAGTRQGMILM 66
            |...::.:|..::.:|.|.|:...|||.......|.||..||:.|||...:...: ||.....|.
  Rat     8 SGESSAVEAPGSQDDRLFLIKGGIFLGSAAAAGMLAGFVTTLSLAKKKSPEWFNK-GTMATAALP 71

  Fly    67 DEGATLALRALGWGTLYAVMGTGAFCYGFWKLSGAKDFQEFRLKMGNALPRITKDEPPASRTDFE 131
            :.|::|||||||||:|||..|.|...:..||..|....::||.||.:..|.|.|:  |.|...:|
  Rat    72 ESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMKDFRSKMQSIFPPIPKN--PESADQWE 134

  Fly   132  131
              Rat   135  134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11699NP_001303568.1 DUF1358 3..118 CDD:284504 41/114 (36%)
Tmem242NP_001138332.1 DUF1358 15..123 CDD:284504 41/108 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337307
Domainoid 1 1.000 78 1.000 Domainoid score I8625
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44020
Inparanoid 1 1.050 81 1.000 Inparanoid score I5118
OMA 1 1.010 - - QHG47459
OrthoDB 1 1.010 - - D1365284at2759
OrthoFinder 1 1.000 - - FOG0008285
OrthoInspector 1 1.000 - - oto97058
orthoMCL 1 0.900 - - OOG6_107908
Panther 1 1.100 - - LDO PTHR13141
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6265
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.