DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11699 and F28D9.4

DIOPT Version :9

Sequence 1:NP_001303568.1 Gene:CG11699 / 32101 FlyBaseID:FBgn0030311 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001366939.1 Gene:F28D9.4 / 173012 WormBaseID:WBGene00009220 Length:160 Species:Caenorhabditis elegans


Alignment Length:103 Identity:24/103 - (23%)
Similarity:40/103 - (38%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LVGG---VSALFGFSRTLATAKKTDSKVLQQAGTRQGMILMDEGATLALRALGWGTLYAVMGTGA 90
            ::||   |:.|.|.......:::.::..|..|       .:..||..|.:|||..|:..|.|...
 Worm    41 VIGGTSLVTLLLGIRSAWKHSRQPEAADLAAA-------QLFSGAAFAGKALGVATVITVSGFTL 98

  Fly    91 FCYGFWKLSGAKDFQEFRLKMGNA------LPRITKDE 122
            |..|...:......::|...|..|      ||:..|.:
 Worm    99 FIVGVSAILQVNSPRQFGSAMKTAFGDSIRLPQSAKSQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11699NP_001303568.1 DUF1358 3..118 CDD:284504 23/97 (24%)
F28D9.4NP_001366939.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107908
Panther 1 1.100 - - LDO PTHR13141
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.