DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII215 and ubxn7

DIOPT Version :9

Sequence 1:NP_511124.1 Gene:RpII215 / 32100 FlyBaseID:FBgn0003277 Length:1887 Species:Drosophila melanogaster
Sequence 2:NP_001001951.1 Gene:ubxn7 / 402913 ZFINID:ZDB-GENE-040704-8 Length:505 Species:Danio rerio


Alignment Length:125 Identity:30/125 - (24%)
Similarity:37/125 - (29%) Gaps:30/125 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1747 YSQTGVKYSPTSPTYSPPSP--------SYDGSPG-------------SPQYTPGSPQYSPASPK 1790
            |..|..|....|...|...|        |.|||..             |.:..|.:...|||..:
Zfish   305 YESTQEKAESRSDDDSDAEPFSDSEGLISVDGSDNEAGAGEDSLDGHTSTELAPPTRSDSPAHHR 369

  Fly  1791 YSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTA 1850
            .||...|.  ...:.|..|...|.|..:..|.       ...:..||...|:.|..|.||
Zfish   370 KSPHKELC--HRKEESKKNHLEPVGLNHGQTG-------QTENHRSTSQQPSEPAGTSTA 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII215NP_511124.1 PRK08566 14..887 CDD:236292
RNAP_II_RPB1_N 15..868 CDD:259848
RNA_pol_Rpb1_5 822..1420 CDD:282807
RNA_pol_Rpb1_6 890..1071 CDD:282801
RNAP_II_Rpb1_C 1050..1468 CDD:132720
TCRP1 1602..1880 CDD:291605 30/125 (24%)
RCR <1789..1864 CDD:304939 15/62 (24%)
ubxn7NP_001001951.1 UBA_UBXD7 15..50 CDD:270530
UAS 151..263 CDD:239256
UBQ 424..505 CDD:294102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.