DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII215 and Ubxn7

DIOPT Version :9

Sequence 1:NP_511124.1 Gene:RpII215 / 32100 FlyBaseID:FBgn0003277 Length:1887 Species:Drosophila melanogaster
Sequence 2:NP_808301.3 Gene:Ubxn7 / 224111 MGIID:2146388 Length:489 Species:Mus musculus


Alignment Length:463 Identity:89/463 - (19%)
Similarity:150/463 - (32%) Gaps:142/463 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 STFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQ----- 531
            ||...::|...|:..    :|:...:||..|...|.|.:...|::      .:|...|..     
Mouse    60 STSSASVSTVRPHTE----EEVRAPIPQKQEILVEPEPLFGAPKR------RRPARSIFDGFRDF 114

  Fly   532 --DTLTAVRKM-----------TKRDVFITREQVMNLLMFLPTWDAKMPQ--------------P 569
              :|:...:::           |..|:|.....:|:...|....:....|              .
Mouse   115 QTETIRQEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFA 179

  Fly   570 CILKPRPLWTGKQIFSLIIPGNVNMIRTHST-----HPDEEDE--------GPYKWISPGD---- 617
            |....|.:|:.:.:        .|:||.|..     |..||.:        |.:.::|..|    
Mouse   180 CQCLNRDVWSNEAV--------KNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTG 236

  Fly   618 ------------------TKVMVEHGELIMGI------LCKKS---LGTSAGSLLHICF---LEL 652
                              |..:.|||:| .|:      .|.:|   :..|..|.|....   |:.
Mouse   237 QKLVEWHQLDVSSFLDQVTGFLGEHGQL-DGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQE 300

  Fly   653 GH-DIAGRFYGNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNME 716
            .| |.|.....:.....:...||.|....|....:|.:  .|::...|..|....::   .|..|
Mouse   301 THFDSAQAKQDSRSDEESESELFSGSEEFISVCGSDEE--EEVENLAKSRKSPHKDL---GHRKE 360

  Fly   717 ------LEP----TPGN-TLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVV---SGSK 767
                  .||    .||. |..|...:..:.:|..:.:|:.|..:.  .:.|..||.::   ...|
Mouse   361 ENRRPLTEPPARTEPGTATNHQGLPSMDSEVLEMSPEKSDGIVEG--IDVNGPKAQLMLRYPDGK 423

  Fly   768 GSNINI---SQVIACVGQQNVEGKRIP-------YGFRKRTLPHFIKDDYGPESRGFVENSYLAG 822
            ...|.:   ::::|.|  ::|:.|..|       ..|.:|.|.|...|....|          ||
Mouse   424 REQITLPEQAKLLALV--KHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQE----------AG 476

  Fly   823 LTPSEFYF 830
            |.|.|..|
Mouse   477 LCPQETVF 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII215NP_511124.1 PRK08566 14..887 CDD:236292 89/463 (19%)
RNAP_II_RPB1_N 15..868 CDD:259848 89/463 (19%)
RNA_pol_Rpb1_5 822..1420 CDD:282807 5/9 (56%)
RNA_pol_Rpb1_6 890..1071 CDD:282801
RNAP_II_Rpb1_C 1050..1468 CDD:132720
TCRP1 1602..1880 CDD:291605
RCR <1789..1864 CDD:304939
Ubxn7NP_808301.3 UBA_UBXD7 16..51 CDD:270530
UAS 149..261 CDD:239256 17/119 (14%)
Faf1_like1_UBX 408..489 CDD:176368 22/89 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.