DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and Pglyrp1

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_445825.1 Gene:Pglyrp1 / 84387 RGDID:621429 Length:183 Species:Rattus norvegicus


Alignment Length:169 Identity:70/169 - (41%)
Similarity:99/169 - (58%) Gaps:9/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NCPTIKLKRQWGGKP---SLGLHYQVRPIRYVVIHHTVTGECSGLLKCAEILQNMQAYHQNELDF 97
            :|..:..:.:|...|   |.||.   :|:|||||.||....||....|.:..:|:|.|...:|.:
  Rat    17 SCCFVVPRSEWKALPSECSKGLK---KPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMKQLGW 78

  Fly    98 NDISYNFLIGNDGIVYEGTGWGLRGAHTYG--YNAIGTGIAFIGNFVDKLPSDAALQAAKDLLAC 160
            .|::||||||.||.||||.||.::|.|| |  :|.:..||.|:|::..::|:..||:||.:||.|
  Rat    79 CDVAYNFLIGEDGHVYEGRGWTIKGDHT-GPIWNPMSIGITFMGDYSHRVPAKRALRAALNLLKC 142

  Fly   161 GVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199
            ||.:|.|..:|.:.....|.||.|||..||..||.|.|:
  Rat   143 GVSEGFLRSNYEVKGHRDVQSTLSPGDQLYEIIQSWDHY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 57/145 (39%)
Pglyrp1NP_445825.1 PGRP 21..161 CDD:128941 57/143 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345830
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm46132
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.720

Return to query results.
Submit another query.