DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and pglyrp1-like.1

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001025626.1 Gene:pglyrp1-like.1 / 595014 XenbaseID:XB-GENE-5778936 Length:182 Species:Xenopus tropicalis


Alignment Length:190 Identity:73/190 - (38%)
Similarity:102/190 - (53%) Gaps:12/190 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WIMAIGLVLLLLAFVSAGKSRQRSPANCPTIKLKRQWGGKPSLGLHYQVRPIRYVVIHHTVTGEC 74
            |:.     :.|.||.:..:       .||.|..:..|||.||.......|.::||:||||....|
 Frog     3 WVF-----IFLTAFCALAQ-------GCPKIISRSSWGGVPSKCQAKLPRSVKYVIIHHTAGASC 55

  Fly    75 SGLLKCAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIG 139
            :....|....:|:|.:|.....:.|..||||||.||.||||.||...|||...||....||:|:|
 Frog    56 NSESACKAQARNIQNFHMKSNGWCDTGYNFLIGEDGQVYEGRGWETVGAHAKNYNFNSIGISFMG 120

  Fly   140 NFVDKLPSDAALQAAKDLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199
            .|.::.|:.||.:|||||::|||.:..::.||.|.....|.:|:.||..|||.|:.||::
 Frog   121 TFTNRAPNTAAQKAAKDLISCGVAKKVINSDYTLKGHRDVSATECPGTNLYNLIKNWPNF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 58/140 (41%)
pglyrp1-like.1NP_001025626.1 PGRP 19..160 CDD:128941 58/140 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.