DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and Pglyrp2

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_006524773.1 Gene:Pglyrp2 / 57757 MGIID:1928099 Length:544 Species:Mus musculus


Alignment Length:185 Identity:69/185 - (37%)
Similarity:112/185 - (60%) Gaps:6/185 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LAFVSAGKSRQRSPA--NCPTIKLKRQWGGKPSLGLHYQVR-PIRYVVIHHTV--TGECSGLLKC 80
            ||.|:...:::.:.|  .||.|..:.:||..|..|....:| |:.::.:|||.  ...|:....|
Mouse   341 LAQVATLATKEFTEAFLGCPAIHPRCRWGAAPYRGHPTPLRLPLGFLYVHHTYVPAPPCTTFQSC 405

  Fly    81 AEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKL 145
            |..:::||.:||:...::||.|:|::|:||.:|:|.||...||||.|||:.|.|:||:||:...|
Mouse   406 AADMRSMQRFHQDVRKWDDIGYSFVVGSDGYLYQGRGWHWVGAHTRGYNSRGFGVAFVGNYTGSL 470

  Fly   146 PSDAALQAAKDLL-ACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199
            |::|||...:|.| :|.::.|.|..||.|:...|::.|..||..|:|.::.|||:
Mouse   471 PNEAALNTVRDALPSCAIRAGLLRPDYKLLGHRQLVLTHCPGNALFNLLRTWPHF 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 55/144 (38%)
Pglyrp2XP_006524773.1 PGRP 360..505 CDD:128941 55/144 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.840

Return to query results.
Submit another query.