DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and pglyrp6

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001038687.2 Gene:pglyrp6 / 571817 ZFINID:ZDB-GENE-071227-2 Length:498 Species:Danio rerio


Alignment Length:175 Identity:73/175 - (41%)
Similarity:102/175 - (58%) Gaps:12/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ANCPTIKLKRQWG-----GKPSLGLHYQVRPIRYVVIHHTV--TGECSGLLKCAEILQNMQAYHQ 92
            |.||.|..:.|||     |.||    |...|:||:.||||.  :..|:...:||..:::||.|||
Zfish   325 AVCPNIITRSQWGAASYIGSPS----YLSLPVRYLFIHHTYQPSKPCTTFEQCAAEMRSMQRYHQ 385

  Fly    93 NELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKLPSDAALQAAK-D 156
            ....::||.|:|:.|:||.:|||.||...||||||||:||.|:.|||::...||:.:|:...: |
Zfish   386 QSNGWSDIGYSFVAGSDGNLYEGRGWNWVGAHTYGYNSIGYGVCFIGDYTSTLPASSAMNMVRYD 450

  Fly   157 LLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHWLS 201
            ...|....|.||:.|:|....|..:|:.||.|||.:||.|..:.|
Zfish   451 FTYCATNGGRLSKSYSLYGHRQAAATECPGNTLYRQIQTWERYQS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 60/148 (41%)
pglyrp6NP_001038687.2 PGRP 328..472 CDD:128941 60/147 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm25319
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.