DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and PGLYRP4

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_065126.2 Gene:PGLYRP4 / 57115 HGNCID:30015 Length:373 Species:Homo sapiens


Alignment Length:176 Identity:67/176 - (38%)
Similarity:103/176 - (58%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RQRSPAN--CPTIKLKRQWGGK----PSLGLHYQVRPIRYVVIHHTVTGECSGLLKCAEILQNMQ 88
            ||::...  ||.:..:..||.:    |.:.|     |.:|.:|.||....|:...:|..:::::|
Human   201 RQKTSLKKACPGVVPRSVWGARETHCPRMTL-----PAKYGIIIHTAGRTCNISDECRLLVRDIQ 260

  Fly    89 AYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKLPSDAALQA 153
            :::.:.|...||.||||:|.||.:|||.||.::|:.|.||:.|..||.|:|.|....|:.|||:|
Human   261 SFYIDRLKSCDIGYNFLVGQDGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAALEA 325

  Fly   154 AKDLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199
            |:||:.|.:.:|.|:.:|.|:..|.|..|.|||..|||.|..|||:
Human   326 AQDLIQCAMVKGYLTPNYLLVGHSDVARTLSPGQALYNIISTWPHF 371

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 52/144 (36%)
PGLYRP4NP_065126.2 PGRP 53..194 CDD:128941
PGRP 211..351 CDD:128941 52/144 (36%)
Interaction with murein 293..302 4/8 (50%)