DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and pglyrp2

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001038631.1 Gene:pglyrp2 / 568634 ZFINID:ZDB-GENE-071227-1 Length:458 Species:Danio rerio


Alignment Length:169 Identity:66/169 - (39%)
Similarity:102/169 - (60%) Gaps:5/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NCPTIKLKRQWG-GKPSLGLHYQVRPIRYVVIHHTV--TGECSGLLKCAEILQNMQAYHQNELDF 97
            :||:|..:..|| ..|.:.|.....|:.::.||||.  :..|..|..|::.::.||.:||.:..:
Zfish   283 DCPSIIPRCIWGAAPPQVPLELLSPPMSFLYIHHTAIPSKPCLNLQTCSQNMRAMQRFHQKDWGW 347

  Fly    98 NDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKLPSDAALQAAK-DLLACG 161
            .||.|:|::|:||.:|||.||..:||||.|.|.:|.|:||||::..:|||...::..: .|:.||
Zfish   348 YDIGYSFVVGSDGYIYEGRGWMSQGAHTKGRNNVGYGVAFIGDYSGRLPSTHDMELVRHHLVKCG 412

  Fly   162 VQQGELSEDYALIAGSQVISTQS-PGLTLYNEIQEWPHW 199
            |..|.|.||:.::...||:.|.| ||..||:||..|.|:
Zfish   413 VNNGFLQEDFTILGHRQVVVTTSCPGNALYSEITTWMHY 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 53/144 (37%)
pglyrp2NP_001038631.1 PGRP 285..430 CDD:128941 53/144 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm25319
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.