DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and Pglyrp3

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001178890.1 Gene:Pglyrp3 / 499658 RGDID:1593164 Length:339 Species:Rattus norvegicus


Alignment Length:167 Identity:71/167 - (42%)
Similarity:106/167 - (63%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 CPTIKLKRQWGGKPS----LGLHYQVRPIRYVVIHHTVTGECSGLLKCAEILQNMQAYHQNELDF 97
            ||.|..:..|..:.:    :.|     |.::|:|.||....|:....|...:::.|::|.::.||
  Rat   176 CPNIIPRTAWEARETHCSQMNL-----PAKFVIIIHTAGESCNESADCLIRVRDTQSFHMDKQDF 235

  Fly    98 NDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKLPSDAALQAAKDLLACGV 162
            .||:|:||:|.||:||||.||.:.|:||||||.|..||||:||||:|.|::|:|:||:.|:.|.|
  Rat   236 CDIAYHFLVGQDGVVYEGVGWTIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLEAAQSLIQCAV 300

  Fly   163 QQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199
            ..|.|:.:|.|:..|.|.:..|||..|||.|:.|||:
  Rat   301 AMGYLASNYLLMGHSDVSNILSPGQALYNIIKTWPHF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 59/144 (41%)
Pglyrp3NP_001178890.1 PGRP 19..152 CDD:128941
PGRP 177..317 CDD:128941 59/144 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345840
Domainoid 1 1.000 129 1.000 Domainoid score I5121
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46132
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.