DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and PGRP-SB2

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster


Alignment Length:131 Identity:55/131 - (41%)
Similarity:72/131 - (54%) Gaps:12/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MAIGLVLLLLAFVSA-GKSRQRSPANCPTIKLKRQWGGKPSLGLHYQVRPIRYVVIHHTVTGECS 75
            |.:.|.|:|.....| |:...|| :.||.....|.    |.|     :.|:|.::||||||..|.
  Fly     1 MKLQLALVLCGLTLALGQIVPRS-SWCPVPISPRM----PRL-----MVPVRLIIIHHTVTAPCF 55

  Fly    76 GLLKCAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGN 140
            ...:|..:|:.::|.|... .|.||.||||||.||.:|||.|:|:||.|...||:...|||||||
  Fly    56 NPHQCQLVLRQIRADHMRR-KFRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGN 119

  Fly   141 F 141
            |
  Fly   120 F 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 46/104 (44%)
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 49/114 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.