DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and PGRP-LF

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster


Alignment Length:195 Identity:69/195 - (35%)
Similarity:105/195 - (53%) Gaps:7/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVLLLLAFVSAG------KSRQRSPANCPTIKLKRQWGGKPSLGLHYQVR-PIRYVVIHHTVTGE 73
            ::||::..::||      .....||.....|..:.:|.|:|..|.:..:: |:..::||||.|..
  Fly    29 VILLMVVGLAAGYFMWMMSFSTHSPNKGLHILDRSEWLGEPPSGKYPHLKLPVSNIIIHHTATEG 93

  Fly    74 CSGLLKCAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFI 138
            |.....|...::.:||:|.....:.||.||||:|.||.:|.|.||.::|.|..||.||...||||
  Fly    94 CEQEDVCIYRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFI 158

  Fly   139 GNFVDKLPSDAALQAAKDLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHWLSNP 203
            |.||:..|....::|||.|:..||:...|..||.:.|..|:..|:|||..|:..:|.||.:..:|
  Fly   159 GTFVNMEPPARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQLSPTESPGQKLFELMQNWPRFTQDP 223

  Fly   204  203
              Fly   224  223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 53/141 (38%)
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 53/141 (38%)
PGRP 236..363 CDD:295442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440251
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.