DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and PGRP-LC

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster


Alignment Length:197 Identity:61/197 - (30%)
Similarity:84/197 - (42%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RQRSPANCPTIKL-------------KRQWGGK------PSLGLHYQVRPIRYVVIHHTVTGECS 75
            ||..|.| .||.|             ::||..:      |.|.|     |:..|:...|.:..||
  Fly   333 RQNIPIN-STIDLDNIGGGLILRFVERQQWLAQPPQKEIPDLEL-----PVGLVIALPTNSENCS 391

  Fly    76 GLLKCAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAH--TYGYNAIGTGIAFI 138
            ....|...::.:|.|........||:||||||.||.||.|.||...|||  ...|::.....|:|
  Fly   392 TQAICVLRVRLLQTYDIESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYI 456

  Fly   139 GNFVDKLPSDAALQAAKDLLACGVQQGELSEDYALIAGSQVISTQSPGLT------LYNEIQEWP 197
            |:|....||...|...:.||..||:.|:::..|...|.|:::    |.:|      ||.....|.
  Fly   457 GSFKTIQPSAKQLSVTRLLLERGVKLGKIAPSYRFTASSKLM----PSVTDFKADALYASFANWT 517

  Fly   198 HW 199
            ||
  Fly   518 HW 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 50/161 (31%)
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 44/138 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.