DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and Pglyrp4

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_038958226.1 Gene:Pglyrp4 / 310611 RGDID:1308520 Length:384 Species:Rattus norvegicus


Alignment Length:174 Identity:75/174 - (43%)
Similarity:104/174 - (59%) Gaps:6/174 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KSRQRSPANCPTIKLKRQWGGKPSLGLH--YQVRPIRYVVIHHTVTGECSGLLKCAEILQNMQAY 90
            |.:|:..| ||.|..:..||.:.|   |  ....|.:|.:|.||....||...:|..::|::|::
  Rat   213 KGKQKKAA-CPHIVPRSAWGARES---HCFKMTLPAKYAIILHTAGRTCSQPDECRLLIQDLQSF 273

  Fly    91 HQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKLPSDAALQAAK 155
            ..:.|:..||.||||:|.||.||||.||..:|:.|.|||.|...|||:|.|....|:.||||||:
  Rat   274 FMDRLNACDIGYNFLVGQDGGVYEGVGWNNQGSKTDGYNDIALSIAFMGIFTGSSPNAAALQAAQ 338

  Fly   156 DLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199
            ||:.|.|.:|.|:.:|.|:..|.|.:|.|||..|||.|:.|||:
  Rat   339 DLIQCAVVKGYLTPNYLLMGHSDVSNTLSPGQALYNIIKTWPHF 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 59/142 (42%)
Pglyrp4XP_038958226.1 PGRP 67..201 CDD:128941
PGRP 222..362 CDD:128941 59/142 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345820
Domainoid 1 1.000 129 1.000 Domainoid score I5121
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.