DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and PGLYRP3

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_011507420.1 Gene:PGLYRP3 / 114771 HGNCID:30014 Length:377 Species:Homo sapiens


Alignment Length:167 Identity:74/167 - (44%)
Similarity:106/167 - (63%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 CPTIKLKRQWGGK----PSLGLHYQVRPIRYVVIHHTVTGECSGLLKCAEILQNMQAYHQNELDF 97
            ||.|..:..|..:    |.:.|     |.:||:|.||....|:....|..:::|:|::|.:..:|
Human   214 CPNIIKRSAWEARETHCPKMNL-----PAKYVIIIHTAGTSCTVSTDCQTVVRNIQSFHMDTRNF 273

  Fly    98 NDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKLPSDAALQAAKDLLACGV 162
            .||.|:||:|.||.||||.||.::|:||||:|.|..||||||.||:|.|:.|||:||:||:.|.|
Human   274 CDIGYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGYFVEKPPNAAALEAAQDLIQCAV 338

  Fly   163 QQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199
            .:|.|:.:|.|:..|.|::..|||..|||.|..|||:
Human   339 VEGYLTPNYLLMGHSDVVNILSPGQALYNIISTWPHF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 62/144 (43%)
PGLYRP3XP_011507420.1 PGRP 57..195 CDD:128941
PGRP 215..355 CDD:128941 62/144 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152342
Domainoid 1 1.000 133 1.000 Domainoid score I5079
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7191
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41991
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.