DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and PGLYRP2

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens


Alignment Length:185 Identity:71/185 - (38%)
Similarity:114/185 - (61%) Gaps:6/185 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LAFVSAGKSRQRSPA--NCPTIKLKRQWGGKPSLGLHYQVR-PIRYVVIHHTV--TGECSGLLKC 80
            ||.|:|..:::.:.|  .||.|..:.:||..|..|....:: |:.::.:|||.  ...|:...:|
Human   361 LAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCTDFTRC 425

  Fly    81 AEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKL 145
            |..:::||.|||:...:.||.|:|::|:||.||||.||...||||.|:|:.|.|:|.:||:...|
Human   426 AANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAAL 490

  Fly   146 PSDAALQAAKDLL-ACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199
            |::|||:..:|.| :|.|:.|.|..||||:...|::.|..||..|::.::.|||:
Human   491 PTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHF 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 57/144 (40%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 57/144 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.