DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SA and pglyrp2

DIOPT Version :9

Sequence 1:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001106487.2 Gene:pglyrp2 / 100127677 XenbaseID:XB-GENE-5779913 Length:497 Species:Xenopus tropicalis


Alignment Length:188 Identity:71/188 - (37%)
Similarity:111/188 - (59%) Gaps:14/188 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LAFVSAGKSRQRSPANCPTIKLKRQWG-----GKP-SLGLHYQVRPIRYVVIHHTV--TGECSGL 77
            :|..:|.:..::...:||.:..:..||     ||| .|||     |:..|.||||.  :..|:..
 Frog   312 IAAGAAAREFEQYFLDCPAVIPRCMWGAKRYKGKPIFLGL-----PLSRVFIHHTYEPSQPCTSF 371

  Fly    78 LKCAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFV 142
            .:||..:::||.:||.:..::||.|:|::|::|.:|||.||...||||.|||::|.|::|||::.
 Frog   372 SQCAANMRSMQRFHQQDRGWDDIGYSFVVGSNGYLYEGRGWNRAGAHTRGYNSVGYGVSFIGDYT 436

  Fly   143 DKLPSDAALQAAKD-LLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199
            ..:|.|:.|...|| .|.|.|:.|.::.:|.:....||:||..||..||.|||.|.|:
 Frog   437 SIVPKDSILALVKDRFLRCAVRLGYITPNYIIQGHRQVVSTSCPGDALYKEIQSWDHF 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 55/149 (37%)
pglyrp2NP_001106487.2 PGRP 329..474 CDD:128941 55/149 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.