DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and Cmtm4

DIOPT Version :10

Sequence 1:NP_572726.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_705810.2 Gene:Cmtm4 / 97487 MGIID:2142888 Length:208 Species:Mus musculus


Alignment Length:141 Identity:30/141 - (21%)
Similarity:59/141 - (41%) Gaps:21/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLKTFPGILKLFELIIGASIVGILAFNYQD--------YHRYFYGQQDLFHYLMAVTFMIGTFCL 82
            ||:...|.||:.::|:     .::||...:        ...||      |.::....|::....|
Mouse    49 YLRGALGRLKVAQVIL-----ALIAFICIETIMECSPCEGLYF------FEFVSCSAFVVTGVLL 102

  Fly    83 LLACLTSLSTGGIIAKTIYELIYHSVAAILILVSSTILLLKLRDVKHDAYMAAGVLGLVNAVLYF 147
            :|..|........|...:.:|:...::.....::|  ::|...:.|..|.:||.:.|.:....|.
Mouse   103 ILFSLNLHMRIPQINWNLTDLVNTGLSTFFFFIAS--IVLAALNHKTGAEIAAVIFGFLATAAYA 165

  Fly   148 ISAFLAHRSYR 158
            :|.|||.:.:|
Mouse   166 VSTFLAMQKWR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_572726.1 MARVEL 26..152 CDD:366555 26/133 (20%)
Cmtm4NP_705810.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
MARVEL 49..170 CDD:366555 26/133 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.