DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and MARVELD1

DIOPT Version :9

Sequence 1:NP_001285126.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_113672.1 Gene:MARVELD1 / 83742 HGNCID:28674 Length:173 Species:Homo sapiens


Alignment Length:147 Identity:34/147 - (23%)
Similarity:63/147 - (42%) Gaps:28/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LNTGYLKTFPGILKLFELIIGASI-VGILAFNYQDYHRYFYGQQDLFHYLMAVTFMIGTFCLLLA 85
            |...:|::..|:|:|.:|:.||:. :.|....|          |...|:.:.|:.:.....|.|.
Human    22 LQRPFLRSPLGVLRLLQLLAGAAFWITIATSKY----------QGPVHFALFVSVLFWLLTLGLY 76

  Fly    86 CLTSLSTGGII----AKTIYELIYHSVAAILILVSSTILL---------LKLRD----VKHDAYM 133
            .||.|....::    ::.:...:.|.|.|..:..::|.::         ..|:|    ..:.|::
Human    77 FLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFL 141

  Fly   134 AAGVLGLVNAVLYFISA 150
            ||.|.|.|...||.:||
Human   142 AAAVCGGVCHGLYLLSA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_001285126.1 MARVEL 26..152 CDD:279608 33/143 (23%)
MARVELD1NP_113672.1 MARVEL 26..160 CDD:366555 33/143 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.