DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and mala.2

DIOPT Version :9

Sequence 1:NP_001285126.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001070931.1 Gene:mala.2 / 768299 ZFINID:ZDB-GENE-061027-365 Length:154 Species:Danio rerio


Alignment Length:158 Identity:44/158 - (27%)
Similarity:69/158 - (43%) Gaps:42/158 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TNTSYIVLNTGYLK-------TFPGILKLFELIIGASIVGILAFNYQDYHRYFYGQQDLFHYLMA 72
            |||..:    |:|.       |.|.||.|.|||.|...:.::|..|    ...|..|   .|:::
Zfish     3 TNTGQM----GFLPSGGAIFCTIPDILYLPELIFGGLTLALVASTY----LIPYNPQ---AYVIS 56

  Fly    73 VT---FMIGTFCLLL-AC-----LTSLSTGGIIAKTIYELIYHSVAAILILV--------SSTIL 120
            ||   |::..|.|:: ||     .:|.::..:.......::|.|.:.:|.||        :.|.|
Zfish    57 VTIFCFIVSFFWLMVFACGSHRNKSSWASADVAYHGFATVLYPSASVLLALVTIGIAQIQTETTL 121

  Fly   121 LLKLRDVKHDAYMAAGVLGLVNAVLYFI 148
            :.:| ||      ||.|...:..:||||
Zfish   122 IYQL-DV------AAVVFSFLTTLLYFI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_001285126.1 MARVEL 26..152 CDD:279608 40/147 (27%)
mala.2NP_001070931.1 MARVEL 18..146 CDD:279608 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.