DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and marveld1

DIOPT Version :9

Sequence 1:NP_001285126.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001189346.1 Gene:marveld1 / 497317 ZFINID:ZDB-GENE-050208-33 Length:162 Species:Danio rerio


Alignment Length:153 Identity:37/153 - (24%)
Similarity:70/153 - (45%) Gaps:28/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLKTFPGILKLFELIIGASIVGILAFNYQDYHRYFYGQQDLFHYLMAVTFMIGTFCLLLACLTSL 90
            :||:|.||:::.::::||.:...:|.|     :|    :...|:::.|..:.....|.:..||.|
Zfish    14 FLKSFVGIVRVLQILLGAGLWVTIAAN-----KY----EGSIHFVLFVAVLFWLLTLAIFILTLL 69

  Fly    91 STGGIIAKT------IYELIYHSVAAILILVSSTILLLKLR-------DV-KH----DAYMAAGV 137
            ....::...      :..||:..||.:|.|.:..|::.|.:       || ||    ..|:.|.|
Zfish    70 DKQDLVPIVGGERWLLSNLIHDVVATLLYLSTIGIMIYKTQKNSYCNLDVYKHHCLYKVYLTASV 134

  Fly   138 LGLVNAVLYFISA-FLAHRSYRG 159
            ...:.|.:|.:|. :.:.|..||
Zfish   135 FACLTAAVYLLSGIYCSCRKCRG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_001285126.1 MARVEL 26..152 CDD:279608 34/144 (24%)
marveld1NP_001189346.1 MARVEL 14..146 CDD:279608 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.