DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and MAL

DIOPT Version :9

Sequence 1:NP_001285126.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_002362.1 Gene:MAL / 4118 HGNCID:6817 Length:153 Species:Homo sapiens


Alignment Length:156 Identity:32/156 - (20%)
Similarity:57/156 - (36%) Gaps:34/156 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TTTSTTNTSYIVLNTGYLKTFPGILKLFELIIGASIVGILAFNYQDYHRYFYGQQDLFHYLMAVT 74
            |..||..:.:.|..     |.|.:|.:||.|.|..:..::|.:...:           ..:....
Human     7 TGGSTLPSGFSVFT-----TLPDLLFIFEFIFGGLVWILVASSLVPW-----------PLVQGWV 55

  Fly    75 FMIGTFCLLLACLTSL-------STGGIIAKTIYELIYHSVAAILILVSSTILLLKLRDVKHDAY 132
            ..:..||.:  ..|:|       :.||..:....:..||..||:..| |:::|.........|.:
Human    56 MFVSVFCFV--ATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYL-SASVLEALATITMQDGF 117

  Fly   133 --------MAAGVLGLVNAVLYFISA 150
                    :||.|...:..:||.:.|
Human   118 TYRHYHENIAAVVFSYIATLLYVVHA 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_001285126.1 MARVEL 26..152 CDD:279608 28/140 (20%)
MALNP_002362.1 MARVEL 19..145 CDD:307448 28/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.