powered by:
Protein Alignment CG1572 and Cmtm2a
DIOPT Version :9
Sequence 1: | NP_001285126.1 |
Gene: | CG1572 / 32098 |
FlyBaseID: | FBgn0030309 |
Length: | 160 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013160.1 |
Gene: | Cmtm2a / 307616 |
RGDID: | 1307501 |
Length: | 167 |
Species: | Rattus norvegicus |
Alignment Length: | 57 |
Identity: | 14/57 - (24%) |
Similarity: | 25/57 - (43%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 IYHSVAAILILVSSTILLLKLRDVKHDAYMAAGVLGLVNAVLYFISAFLAHRSYRGI 160
:.:|:.:.:.|..|.....|.|......|:.|.:...|.|:..|:..||....:||:
Rat 108 LLNSLFSCVFLAGSVFFAFKARRTLPKPYLTAMIFMGVAAISCFLDIFLQLPHFRGL 164
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG1572 | NP_001285126.1 |
MARVEL |
26..152 |
CDD:279608 |
10/47 (21%) |
Cmtm2a | NP_001013160.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4788 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.