DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and Cmtm8

DIOPT Version :10

Sequence 1:NP_572726.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_942049.1 Gene:Cmtm8 / 301045 RGDID:735040 Length:173 Species:Rattus norvegicus


Alignment Length:87 Identity:24/87 - (27%)
Similarity:48/87 - (55%) Gaps:17/87 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHSVTITRTT----TSTTNTSYIVLNTGYLKTFPGILKLFELIIGASIVGILAFNYQDYHR---- 58
            ||:||.|.::    .|||::|: ..:..:|:|.||:|.:.|:::|..:..::|..  :|.|    
  Rat     9 SHTVTTTSSSFAENFSTTSSSF-AYDREFLRTPPGLLIIAEIVLGLLVWTLIAGT--EYFRVPAF 70

  Fly    59 ---YFYGQQDLFHYLMAVTFMI 77
               .|..   :|::::.|.|:|
  Rat    71 GWVMFVA---VFYWVLTVFFLI 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_572726.1 MARVEL 26..152 CDD:366555 15/59 (25%)
Cmtm8NP_942049.1 MARVEL 36..162 CDD:366555 15/59 (25%)

Return to query results.
Submit another query.