DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and M60.4

DIOPT Version :9

Sequence 1:NP_001285126.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001024815.1 Gene:M60.4 / 187465 WormBaseID:WBGene00019780 Length:162 Species:Caenorhabditis elegans


Alignment Length:164 Identity:43/164 - (26%)
Similarity:70/164 - (42%) Gaps:36/164 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ITRTTTSTTNTSY-----------IVLNTGYLKTFPGILKLFELIIGASIVGILAFNYQDYHRYF 60
            |..|||.||.|.:           |.|||.||.|..||:|:.::|.|..|..:|...:       
 Worm     3 IITTTTRTTRTYHTTSNGSPAMGEISLNTHYLSTNRGIIKILQIIAGFIICSLLCSQW------- 60

  Fly    61 YGQQDLF-----HYLMAVTF--MIGTFCLLLACLTSLSTGGIIAKTIYELIYHSVAAILILVSST 118
            ||.:..|     .:...:.|  :|....|.:....::...|:      |.||..:..||.|::|.
 Worm    61 YGGRSCFGEGRLGFSSGLNFVCVIVNIVLFILNFLNIRAWGL------ERIYTVICTILFLIASI 119

  Fly   119 ILLLKLRDVKHDAYMAAGVLGLVNAVLYFISAFL 152
            :::..:.:|.    .:.|.| :.:|||..:..||
 Worm   120 LIVWFVIEVN----SSRGWL-IASAVLIIVQFFL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_001285126.1 MARVEL 26..152 CDD:279608 30/132 (23%)
M60.4NP_001024815.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.