DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and K09G1.1

DIOPT Version :9

Sequence 1:NP_001285126.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001256125.1 Gene:K09G1.1 / 179346 WormBaseID:WBGene00010727 Length:246 Species:Caenorhabditis elegans


Alignment Length:191 Identity:47/191 - (24%)
Similarity:80/191 - (41%) Gaps:39/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHSVTIT-RTTTSTTNTSYI----------------------VLNTGYLKTFPGILKLFELIIG 42
            ||.:..|| |....||.|..:                      .||||||.|..|:||:.|:::.
 Worm    48 MSETEIITIRKPDGTTETKTVEKKKLQFHMANKVKIIPTNRQGQLNTGYLATLAGVLKIAEIVLS 112

  Fly    43 --ASIVGILAFNYQDYHRYFYGQQDLFHYLMAVTFMIGTFCLL--LACLTSLSTGGIIAKTIYEL 103
              |.|:.|.|.....  ...:.:...|..|:.|:.::..:.:.  |......:..|:|   :.||
 Worm   113 FIAFILAICADRRTT--TAAWTEHISFETLLIVSALLLGYVVFPHLTIKDEATREGLI---VVEL 172

  Fly   104 IYHSVAAILILVSSTILLLKL-----RDVKHDAYMAAGVLGLVNAVLYFISAFLAHRSYRG 159
            |::.|..:|..: |..|::.|     .|.:..|.|.| |:.:...||:.|...:..:::||
 Worm   173 IFYGVNTLLYFI-SIWLMVHLSASWGTDGRGAAIMTA-VICVALTVLFAIETVVKLKAWRG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_001285126.1 MARVEL 26..152 CDD:279608 33/134 (25%)
K09G1.1NP_001256125.1 MARVEL 96..224 CDD:366555 33/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120910
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.