DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and CMTM2

DIOPT Version :10

Sequence 1:NP_572726.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_653274.1 Gene:CMTM2 / 146225 HGNCID:19173 Length:248 Species:Homo sapiens


Alignment Length:116 Identity:26/116 - (22%)
Similarity:42/116 - (36%) Gaps:43/116 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILAFNYQDYHRY----FYGQQDLFHYLMAVTFMIGTFCLLLACLTSLSTGGIIAKTIYELIYHSV 108
            ||.:::. .|||    .:...|||:.|:|..|::|.....:....|::            :::.:
Human   129 ILLYSFA-IHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMN------------LHYLL 180

  Fly   109 AAILILVSSTILLLKLRDVKHDAYMAAGVLGLVNAVLYFISAFLAHRSYRG 159
            |.|||                   .||||..       ||...|....:||
Human   181 AVILI-------------------GAAGVFA-------FIDVCLQRNHFRG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_572726.1 MARVEL 26..152 CDD:366555 23/107 (21%)
CMTM2NP_653274.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
MARVEL 82..198 CDD:366555 23/107 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..248
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.