DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1572 and Cmtm1

DIOPT Version :9

Sequence 1:NP_001285126.1 Gene:CG1572 / 32098 FlyBaseID:FBgn0030309 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_871790.2 Gene:Cmtm1 / 100504164 MGIID:2447159 Length:303 Species:Mus musculus


Alignment Length:91 Identity:25/91 - (27%)
Similarity:46/91 - (50%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GQQDLFHYLMAVTFMIGTFCLLLACLTSLSTGGIIAKTIYELIYHSVAAILILVSSTILLLKLRD 126
            |.|:||..:|.....|..|.:::..:|..:|...|...:.:||..:::.:.:.:...:::.| ::
Mouse   186 GAQELFVVIMIQETCIVLFFIIIYLVTLQTTMACIHWPLLDLINSAISTVFLGIVGIVVIGK-KN 249

  Fly   127 VKHDAYMAAGVLGLVNAVLYFISAFL 152
            .| |...|.|:|.|..|||..|.|.|
Mouse   250 TK-DLCYAGGILCLSAAVLCVIDALL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1572NP_001285126.1 MARVEL 26..152 CDD:279608 24/89 (27%)
Cmtm1NP_871790.2 BAT2_N <30..108 CDD:284431
MARVEL 172..274 CDD:279608 24/89 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.