DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and AT1G49580

DIOPT Version :9

Sequence 1:NP_001162723.1 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_175381.1 Gene:AT1G49580 / 841382 AraportID:AT1G49580 Length:606 Species:Arabidopsis thaliana


Alignment Length:283 Identity:83/283 - (29%)
Similarity:134/283 - (47%) Gaps:17/283 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RGKFAAVRRAIHKN---TGSHFAAKFL-KRRRRAQSSDKEIKHEIAVLMLCEGEDNIVNLNAVHE 105
            ||.|.....|..|.   .|...|.|.: |.:.....:.::::.|:.:|....|..|:|......|
plant   158 RGHFGYTCSAKFKKGELKGQVVAVKIIPKSKMTTAIAIEDVRREVKILQALSGHKNLVQFYDAFE 222

  Fly   106 TRSDTALLLELATGGE-LQTILDNEECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLA 169
            ..::..:.:||..||| |..||......:|..|:..:.::|..:.|.|.:.:.|.||||:|.|..
plant   223 DNANVYIAMELCEGGELLDRILARGGKYSENDAKPVIIQILNVVAFCHFQGVVHRDLKPENFLYT 287

  Fly   170 GERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGVLTYVLLSGF 234
            .:.....||..|||:|..|.....:.::.|:..||||||| :...:...|:||:||:.|:||.|.
plant   288 SKEENSQLKAIDFGLSDFVRPDERLNDIVGSAYYVAPEVL-HRSYTTEADVWSIGVIAYILLCGS 351

  Fly   235 SPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNATGCLDHIWLKD-- 297
            .||...|:...|..:.:...:|.:..:..:|..|.||::|.|...|..||:|:..|.|.|::.  
plant   352 RPFWARTESGIFRAVLKADPSFDEPPWPFLSSDAKDFVKRLLFKDPRRRMSASQALMHPWIRAYN 416

  Fly   298 -------DCSLDRQI--YLQPQS 311
                   |..:.||:  ||:..|
plant   417 TDMNIPFDILIFRQMKAYLRSSS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_001162723.1 STKc_DRAK 28..295 CDD:271008 76/254 (30%)
S_TKc 45..295 CDD:214567 76/254 (30%)
PHA03255 379..>554 CDD:165513
AT1G49580NP_175381.1 S_TKc 151..412 CDD:214567 76/254 (30%)
STKc_CAMK 151..411 CDD:270687 76/253 (30%)
FRQ1 452..592 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.