DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and CDPK1

DIOPT Version :9

Sequence 1:NP_001162723.1 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_564066.2 Gene:CDPK1 / 838470 AraportID:AT1G18890 Length:545 Species:Arabidopsis thaliana


Alignment Length:256 Identity:79/256 - (30%)
Similarity:126/256 - (49%) Gaps:6/256 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSD-KEIKHEIAVLMLCEGEDNIVNLNAVHETRS 108
            ||:|........:.|....|.|.:.:|:...:.| ::::.|:|::.......|:|.|.|.:|...
plant    71 RGEFGITYLCTDRETHEALACKSISKRKLRTAVDIEDVRREVAIMSTLPEHPNVVKLKASYEDNE 135

  Fly   109 DTALLLELATGGELQTILDNEECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGERI 173
            :..|::||..||||...:......||..|....|.:.:.:...|...:.|.||||:|.|.|.::.
plant   136 NVHLVMELCEGGELFDRIVARGHYTERAAAAVARTIAEVVMMCHSNGVMHRDLKPENFLFANKKE 200

  Fly   174 EDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQ--YEPLSLLTDIWSVGVLTYVLLSGFSP 236
            ...||..|||:|.....|....|:.|:|.|:|||||:  |.|   ..|:||.||:.|:||.|..|
plant   201 NSPLKAIDFGLSVFFKPGDKFTEIVGSPYYMAPEVLKRDYGP---GVDVWSAGVIIYILLCGVPP 262

  Fly   237 FGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNATGCLDHIWLKD 297
            |..:|:|...|.|.:..|.|..:.:..:|..|...:::.|...|..|:.|...|.|.|:::
plant   263 FWAETEQGVALAILRGVLDFKRDPWPQISESAKSLVKQMLDPDPTKRLTAQQVLAHPWIQN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_001162723.1 STKc_DRAK 28..295 CDD:271008 78/252 (31%)
S_TKc 45..295 CDD:214567 78/252 (31%)
PHA03255 379..>554 CDD:165513
CDPK1NP_564066.2 STKc_CAMK 62..320 CDD:270687 78/251 (31%)
FRQ1 360..506 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.