DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and CPK4

DIOPT Version :9

Sequence 1:NP_001162723.1 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_192695.1 Gene:CPK4 / 826541 AraportID:AT4G09570 Length:501 Species:Arabidopsis thaliana


Alignment Length:257 Identity:76/257 - (29%)
Similarity:131/257 - (50%) Gaps:6/257 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSD-KEIKHEIAVLMLCEGEDNIVNLNAVHETRS 108
            :|:|........|::.:::|.|.:.:|:.....| :::..||.::.......|:|.:...:|...
plant    33 QGQFGTTYLCTEKSSSANYACKSIPKRKLVCREDYEDVWREIQIMHHLSEHPNVVRIKGTYEDSV 97

  Fly   109 DTALLLELATGGELQTILDNEECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGERI 173
            ...:::|:..||||...:.::.|.:|.:|...::.:|..::..|...:.|.||||:|.|......
plant    98 FVHIVMEVCEGGELFDRIVSKGCFSEREAAKLIKTILGVVEACHSLGVMHRDLKPENFLFDSPSD 162

  Fly   174 EDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQ--YEPLSLLTDIWSVGVLTYVLLSGFSP 236
            :..||..|||:|.....|..:.::.|:|.|||||||:  |.|   ..|:||.||:.|:||||..|
plant   163 DAKLKATDFGLSVFYKPGQYLYDVVGSPYYVAPEVLKKCYGP---EIDVWSAGVILYILLSGVPP 224

  Fly   237 FGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNATGCLDHIWLKDD 298
            |..:|:...|..|.|..:.|..:.:..:|..|.|.|.:.|...|..|::|...|.|.|:.|:
plant   225 FWAETESGIFRQILQGKIDFKSDPWPTISEGAKDLIYKMLDRSPKKRISAHEALCHPWIVDE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_001162723.1 STKc_DRAK 28..295 CDD:271008 74/252 (29%)
S_TKc 45..295 CDD:214567 74/252 (29%)
PHA03255 379..>554 CDD:165513
CPK4NP_192695.1 STKc_CAMK 24..282 CDD:270687 74/251 (29%)
PTZ00184 319..461 CDD:185504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.