DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and AT3G19100

DIOPT Version :9

Sequence 1:NP_001162723.1 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_188541.1 Gene:AT3G19100 / 821445 AraportID:AT3G19100 Length:599 Species:Arabidopsis thaliana


Alignment Length:271 Identity:81/271 - (29%)
Similarity:129/271 - (47%) Gaps:25/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 HF----AAKFLKRRRRAQS---------------SDKEIKHEIAVLMLCEGEDNIVNLNAVHETR 107
            ||    :|||.|...:.|.               |.::::.|:.:|....|..|:|......|..
plant   154 HFGYTCSAKFKKGELKDQEVAVKVIPKSKMTSAISIEDVRREVKILRALSGHQNLVQFYDAFEDN 218

  Fly   108 SDTALLLELATGGE-LQTILDNEECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGE 171
            ::..:::||..||| |..||......:|..|:..:.::|..:.|.|.:.:.|.||||:|.|...:
plant   219 ANVYIVMELCGGGELLDRILARGGKYSEDDAKAVLIQILNVVAFCHLQGVVHRDLKPENFLYTSK 283

  Fly   172 RIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGVLTYVLLSGFSP 236
            .....||:.|||:|..|.....:.::.|:..||||||| :...:...|:||:||:.|:||.|..|
plant   284 EENSMLKVIDFGLSDFVRPDERLNDIVGSAYYVAPEVL-HRSYTTEADVWSIGVIAYILLCGSRP 347

  Fly   237 FGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNATGCLDHIWL----KD 297
            |...|:...|..:.:...:|.:..:..:|..|.||::|.|...|..||.|:..|.|.|:    |.
plant   348 FWARTESGIFRAVLKADPSFDEPPWPSLSFEAKDFVKRLLYKDPRKRMTASQALMHPWIAGYKKI 412

  Fly   298 DCSLDRQIYLQ 308
            |...|..|:.|
plant   413 DIPFDILIFKQ 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_001162723.1 STKc_DRAK 28..295 CDD:271008 75/252 (30%)
S_TKc 45..295 CDD:214567 75/252 (30%)
PHA03255 379..>554 CDD:165513
AT3G19100NP_188541.1 STKc_CAMK 145..405 CDD:270687 75/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.