DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and TTN

DIOPT Version :10

Sequence 1:NP_996411.2 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001254479.2 Gene:TTN / 7273 HGNCID:12403 Length:35991 Species:Homo sapiens


Alignment Length:783 Identity:173/783 - (22%)
Similarity:296/783 - (37%) Gaps:208/783 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DVDADR----LKGLLVSCPDINEIYEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQS 76
            :||..|    .|....|..::.|.|.:.: ...||:|..|.|.:..::...:.|||:|    .:.
Human 33795 EVDETREVSMTKASHSSTKELYEKYMIAE-DLGRGEFGIVHRCVETSSKKTYMAKFVK----VKG 33854

  Fly    77 SDKE-IKHEIAVLMLCEGEDNIVNLNAVHETRSDTALLLELATGGEL-QTILDNEECLTEAQARH 139
            :|:. :|.||::|.:.. ..||::|:...|:..:..::.|..:|.:: :.|..:...|.|.:...
Human 33855 TDQVLVKKEISILNIAR-HRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVS 33918

  Fly   140 CMREVLKALKFLHDRSIAHLDLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYV 204
            .:.:|.:||:|||..:|.|.|::|:||:....| ...:|:.:||.:|.:..|.|.|.:...|:|.
Human 33919 YVHQVCEALQFLHSHNIGHFDIRPENIIYQTRR-SSTIKIIEFGQARQLKPGDNFRLLFTAPEYY 33982

  Fly   205 APEVLQYEPLSLLTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAI 269
            ||||.|::.:|..||:||:|.|.||||||.:||..:|.|:...||.....||.:..|..:|..|:
Human 33983 APEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDEEAFKEISIEAM 34047

  Fly   270 DFIRRALRIKPNDRMNATGCLDHIWLKDDCSLDRQIYLQPQSDAEEEEEEDVDDDVEDEEEEEQV 334
            ||:.|.|..:...||.|:..|.|.|||                                      
Human 34048 DFVDRLLVKERKSRMTASEALQHPWLK-------------------------------------- 34074

  Fly   335 EEEEEETQNVEEPTTEAPQQQQQPVQQHQLAKS--GQIHS--KPTHNGHHRANSGGSISKIPIAT 395
                   |.:|..:|:..:..:.....|.|.|.  ..:.|  :.:..|..|:..|.|::|:.:|:
Human 34075 -------QKIERVSTKVIRTLKHRRYYHTLIKKDLNMVVSAARISCGGAIRSQKGVSVAKVKVAS 34132

  Fly   396 SKLQSTPSSETTTAIHTLTSNSNGHV---------HKPTQIV--TPTRRASDSDK---------- 439
            .:: ...|.:...|:    ....|||         .:.||:.  ...|:..:|:|          
Human 34133 IEI-GPVSGQIMHAV----GEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVA 34192

  Fly   440 -------------------------ENTYTATFVK-----------------------------K 450
                                     :::|...|||                             .
Human 34193 ILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERP 34257

  Fly   451 PVATIQLGSSNGI--EDATVVATLTLFPDAPTT-PKVIRKTPTGESNGSAT--SVKALVKKFQL- 509
            |..|:.|.:....  |:.....|:|:.|:...| .|..:|...|:::...|  |.|.|   :|| 
Human 34258 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGL---YQLT 34319

  Fly   510 -------EDSSGSAVARRSGG--------AVTSSSGLHSPTTTSVRLNSIRRASEPLTTVYKKQT 559
                   :|:..:.|||...|        .||    ||.|.|.|    ::|...:.|....:.|.
Human 34320 INSVTTDDDAEYTVVARNKYGEDSCKAKLTVT----LHPPPTDS----TLRPMFKRLLANAECQE 34376

  Fly   560 SQNGCSSTSNPSSSP-------GSSPTTSGSTATLL-----IHSQRLGNSTAPASHCVAVPATAT 612
            .|:.|.........|       ...|.:.|....::     .::..:.::....:....|.||.|
Human 34377 GQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNT 34441

  Fly   613 ATSSASSSNSSSGKSTSAAHHLHHHHMHH----------HHHHHHHHVVIAAKNAAAVAATNNLS 667
            |            .|||...||....:.:          |..|....:....:.|..::.|.::.
Human 34442 A------------GSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQIDKTLRMAEILSGTESVP 34494

  Fly   668 LDQ 670
            |.|
Human 34495 LTQ 34497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_996411.2 STKc_DRAK 28..295 CDD:271008 86/268 (32%)
PHA03255 379..>554 CDD:165513 50/270 (19%)
TTNNP_001254479.2 Ig strand G 7784..7787 CDD:409564
I-set 7795..7885 CDD:400151
Ig strand B 7812..7816 CDD:409353
Ig strand C 7825..7829 CDD:409353
Ig strand E 7851..7855 CDD:409353
Ig strand F 7865..7870 CDD:409353
Ig strand G 7878..7881 CDD:409353
I-set 7890..7978 CDD:400151
Ig strand B 7906..7910 CDD:143224
Ig strand C 7919..7923 CDD:143224
Ig strand E 7944..7948 CDD:143224
Ig strand F 7958..7963 CDD:143224
I-set 7985..8074 CDD:400151
Ig strand B 8002..8006 CDD:409564
Ig strand C 8015..8019 CDD:409564
Ig strand E 8040..8044 CDD:409564
Ig strand F 8054..8059 CDD:409564
Ig strand G 8067..8070 CDD:409564
I-set 8078..8167 CDD:400151
Ig strand B 8095..8099 CDD:409564
Ig strand C 8108..8112 CDD:409564
Ig strand E 8133..8137 CDD:409564
Ig strand F 8147..8152 CDD:409564
Ig strand G 8160..8163 CDD:409564
I-set 8173..8260 CDD:400151
Ig strand B 8188..8192 CDD:409353
Ig strand C 8201..8205 CDD:409353
Ig strand E 8226..8230 CDD:409353
Ig strand F 8240..8245 CDD:409353
Ig strand G 8253..8256 CDD:409353
I-set 8264..8353 CDD:400151
Ig strand B 8281..8285 CDD:409353
Ig strand C 8294..8298 CDD:409353
Ig strand E 8319..8323 CDD:409353
Ig strand F 8333..8338 CDD:409353
Ig strand G 8347..8350 CDD:409353
I-set 8360..8448 CDD:400151
Ig strand B 8377..8381 CDD:409353
Ig strand C 8390..8394 CDD:409353
Ig strand E 8415..8419 CDD:409353
Ig strand F 8429..8434 CDD:409353
I-set 8456..8545 CDD:400151
Ig strand B 8473..8477 CDD:409353
Ig strand C 8486..8490 CDD:409353
Ig strand E 8511..8515 CDD:409353
Ig strand F 8525..8530 CDD:409353
Ig strand G 8538..8541 CDD:409353
I-set 8549..8626 CDD:400151
Ig strand C 8580..8584 CDD:409353
Ig strand E 8605..8609 CDD:409353
Ig strand F 8619..8624 CDD:409353
I-set 8643..8726 CDD:400151
Ig strand B 8660..8664 CDD:409564
Ig strand C 8673..8677 CDD:409564
Ig strand E 8698..8702 CDD:409564
Ig strand F 8712..8717 CDD:409564
Ig strand G 8725..8728 CDD:409564
I-set 8736..8826 CDD:400151
Ig strand B 8753..8757 CDD:409353
Ig strand C 8766..8770 CDD:409353
Ig strand E 8792..8796 CDD:409353
Ig strand F 8806..8811 CDD:409353
I-set 8832..8919 CDD:400151
Ig strand B 8847..8851 CDD:409564
Ig strand C 8860..8864 CDD:409564
Ig strand E 8885..8889 CDD:409564
Ig strand F 8899..8904 CDD:409564
Ig strand G 8912..8915 CDD:409564
I-set 8926..9015 CDD:400151
Ig strand B 8943..8947 CDD:409570
Ig strand C 8956..8960 CDD:409570
Ig strand E 8979..8985 CDD:409570
Ig strand F 8995..9000 CDD:409570
Ig strand G 9008..9011 CDD:409570
I-set 9019..9106 CDD:400151
Ig strand B 9036..9040 CDD:409353
Ig strand C 9049..9053 CDD:409353
Ig strand E 9074..9078 CDD:409353
Ig strand F 9088..9093 CDD:409353
Ig strand G 9101..9104 CDD:409353
I-set 9113..9198 CDD:400151
Ig strand B 9129..9133 CDD:409353
Ig strand C 9142..9146 CDD:409353
Ig strand E 9167..9171 CDD:409353
Ig strand F 9181..9186 CDD:409353
I-set 9205..9294 CDD:400151
Ig strand B 9222..9226 CDD:409353
Ig strand C 9235..9239 CDD:409353
Ig strand E 9260..9264 CDD:409353
Ig strand F 9274..9279 CDD:409353
Ig strand G 9287..9290 CDD:409353
I-set 9301..9389 CDD:400151
Ig strand B 9318..9322 CDD:409564
Ig strand C 9331..9335 CDD:409564
Ig strand E 9356..9360 CDD:409564
Ig strand F 9370..9375 CDD:409564
Ig strand G 9383..9386 CDD:409564
I-set 9397..9486 CDD:400151
Ig strand B 9414..9418 CDD:409353
Ig strand C 9427..9431 CDD:409353
Ig strand E 9453..9456 CDD:409353
Ig strand F 9466..9471 CDD:409353
Ig strand G 9479..9482 CDD:409353
Ig 9493..9583 CDD:472250
Ig strand B 9511..9515 CDD:409353
Ig strand C 9524..9528 CDD:409353
Ig strand E 9549..9553 CDD:409353
Ig strand F 9563..9568 CDD:409353
Ig strand G 9576..9579 CDD:409353
I-set 9590..9679 CDD:400151
Ig strand B 9607..9611 CDD:409353
Ig strand C 9620..9624 CDD:409353
Ig strand E 9645..9649 CDD:409353
Ig strand F 9659..9664 CDD:409353
I-set 9700..9788 CDD:400151
Ig strand B 9715..9719 CDD:409353
Ig strand C 9728..9732 CDD:409353
Ig strand E 9754..9758 CDD:409353
Ig strand F 9768..9773 CDD:409353
Ig strand G 9781..9784 CDD:409353
THB 9822..9852 CDD:465725
Ig 9906..9986 CDD:472250
Ig strand C 9931..9935 CDD:409353
Ig strand E 9956..9960 CDD:409353
Ig 9989..10071 CDD:472250
Ig strand B 10006..10010 CDD:409353
Ig strand C 10018..10022 CDD:409353
Ig strand E 10043..10047 CDD:409353
Ig strand G 10066..10069 CDD:409353
I-set 10079..10165 CDD:400151
Ig strand B 10095..10099 CDD:409353
Ig strand C 10107..10111 CDD:409353
Ig strand E 10132..10136 CDD:409353
Ig strand F 10146..10151 CDD:409353
Ig strand G 10160..10163 CDD:409353
PTZ00121 <10430..10979 CDD:173412
PspC_subgroup_2 <10506..10657 CDD:468202
PPAK 11272..11298 CDD:460711
PPAK 11300..11326 CDD:460711
PTZ00449 <11736..12108 CDD:185628
rne <12272..12417 CDD:236766
PHA03247 <12536..12909 CDD:223021
PRK10819 <13140..>13230 CDD:236768
PspC_subgroup_2 <13175..13514 CDD:468202
Ig 13684..13775 CDD:472250
Ig strand B 13704..13708 CDD:409353
Ig strand C 13717..13720 CDD:409353
Ig strand E 13741..13745 CDD:409353
Ig strand F 13755..13760 CDD:409353
IG_like 13788..13858 CDD:214653
IG_like 13881..>13945 CDD:214653
Ig 14056..14138 CDD:472250
Ig strand B 14071..14075 CDD:409565
IgI_1_Titin_Z1z2-like 6..98 CDD:409566
Ig strand A 6..8 CDD:409566
Ig strand A' 11..16 CDD:409566
Ig strand B 23..31 CDD:409566
Ig strand C 36..40 CDD:409566
Ig strand C' 44..46 CDD:409566
Ig strand D 53..59 CDD:409566
Ig strand E 62..67 CDD:409566
Ig strand F 76..84 CDD:409566
Ig strand G 87..98 CDD:409566
IgI_2_Titin_Z1z2-like 103..193 CDD:409564
Ig strand A 103..106 CDD:409564
Ig strand A' 109..113 CDD:409564
Ig strand B 121..129 CDD:409564
Ig strand C 134..139 CDD:409564
Ig strand C' 142..144 CDD:409564
Ig strand D 150..155 CDD:409564
Ig strand E 158..163 CDD:409564
Ig strand F 172..180 CDD:409564
Ig strand G 183..193 CDD:409564
PTZ00121 <463..783 CDD:173412
I-set 943..1032 CDD:400151
Ig strand B 960..964 CDD:409564
Ig strand C 973..977 CDD:409564
Ig strand E 998..1002 CDD:409564
Ig strand F 1012..1017 CDD:409564
Ig strand G 1025..1028 CDD:409564
I-set 1082..1171 CDD:400151
Ig strand B 1099..1103 CDD:409353
Ig strand C 1112..1116 CDD:409353
Ig strand E 1139..1143 CDD:409353
Ig strand F 1153..1158 CDD:409353
Ig strand G 1166..1169 CDD:409353
Ig 1293..1381 CDD:472250
Ig strand B 1308..1312 CDD:409353
Ig strand C 1321..1325 CDD:409353
Ig strand E 1347..1351 CDD:409353
Ig strand F 1361..1366 CDD:409353
Ig strand G 1374..1377 CDD:409353
Ig 1457..1547 CDD:472250
Ig strand B 1474..1478 CDD:409353
Ig strand C 1487..1491 CDD:409353
Ig strand E 1513..1517 CDD:409353
Ig strand F 1527..1532 CDD:409353
Ig strand G 1540..1543 CDD:409353
Ig 1556..1647 CDD:472250
Ig strand B 1573..1577 CDD:409353
Ig strand C 1586..1590 CDD:409353
Ig strand E 1613..1617 CDD:409353
Ig strand F 1627..1632 CDD:409353
Ig strand G 1640..1643 CDD:409353
Ig <1722..1794 CDD:472250
Ig strand C 1735..1739 CDD:409564
Ig strand E 1760..1764 CDD:409564
Ig strand F 1774..1779 CDD:409564
Ig strand G 1787..1790 CDD:409564
I-set 1841..1929 CDD:400151
Ig strand B 1858..1862 CDD:409353
Ig strand C 1871..1875 CDD:409353
Ig strand E 1895..1899 CDD:409353
Ig strand F 1909..1914 CDD:409353
Ig strand G 1922..1925 CDD:409353
IgI_titin_I1-like 2078..2169 CDD:409543
Ig strand A 2078..2080 CDD:409543
Ig strand A' 2082..2088 CDD:409543
Ig strand B 2095..2102 CDD:409543
Ig strand C 2108..2113 CDD:409543
Ig strand C' 2115..2118 CDD:409543
Ig strand D 2124..2128 CDD:409543
Ig strand E 2133..2140 CDD:409543
Ig strand F 2147..2155 CDD:409543
Ig strand G 2158..2169 CDD:409543
Ig 2176..2262 CDD:472250
Ig strand B 2192..2196 CDD:409353
Ig strand C 2204..2208 CDD:409353
Ig strand E 2229..2233 CDD:409353
Ig strand F 2243..2247 CDD:409353
Ig 2268..2352 CDD:472250
Ig strand B 2285..2288 CDD:409353
Ig strand C 2296..2300 CDD:409353
Ig strand E 2321..2325 CDD:409353
Ig 2357..2428 CDD:472250
Ig strand B 2373..2377 CDD:409353
Ig strand C 2385..2389 CDD:409353
Ig strand E 2410..2414 CDD:409353
Ig strand F 2424..2428 CDD:409353
Ig 2447..2530 CDD:472250
Ig strand B 2462..2466 CDD:409353
Ig strand C 2475..2479 CDD:409353
Ig strand E 2500..2504 CDD:409353
Ig strand F 2514..2519 CDD:409353
Ig strand G 2523..2526 CDD:409353
Ig 2534..2617 CDD:472250
Ig 2622..2704 CDD:472250
Ig strand C 2649..2653 CDD:409353
Ig strand E 2674..2678 CDD:409353
Ig strand F 2688..2693 CDD:409353
Ig strand G 2697..2700 CDD:409353
Ig 2708..2792 CDD:472250
Ig 2796..2879 CDD:472250
Ig strand B 2812..2816 CDD:409353
Ig strand C 2825..2828 CDD:409353
Ig strand E 2849..2853 CDD:409353
Ig strand F 2863..2868 CDD:409353
Ig strand G 2872..2875 CDD:409353
Ig 2883..2966 CDD:472250
Ig strand B 2899..2903 CDD:409565
Ig strand C 2912..2915 CDD:409565
Ig strand E 2936..2940 CDD:409565
Ig strand F 2950..2955 CDD:409565
Ig strand G 2963..2966 CDD:409565
Ig 2971..3053 CDD:472250
Ig strand B 2986..2990 CDD:409353
Ig strand C 2998..3002 CDD:409353
Ig strand E 3023..3027 CDD:409353
Ig strand F 3037..3042 CDD:409353
Ig strand G 3046..3049 CDD:409353
I-set 3059..3142 CDD:400151
Ig strand B 3075..3079 CDD:409353
Ig strand C 3087..3091 CDD:409353
Ig strand E 3112..3116 CDD:409353
Ig strand F 3126..3131 CDD:409353
Ig 3153..3233 CDD:472250
Ig strand B 3164..3168 CDD:409353
Ig strand C 3176..3180 CDD:409353
Ig strand E 3201..3207 CDD:409353
Ig strand F 3217..3222 CDD:409353
Ig strand G 3226..3229 CDD:409353
Ig 3239..3329 CDD:472250
Ig strand B 3256..3260 CDD:409353
Ig strand C 3269..3273 CDD:409353
Ig strand E 3294..3298 CDD:409353
Ig strand F 3308..3313 CDD:409353
Ig strand G 3321..3324 CDD:409353
I-set 3345..3431 CDD:400151
Ig strand B 3362..3366 CDD:409564
Ig strand C 3374..3378 CDD:409564
Ig strand E 3399..3403 CDD:409564
Ig strand F 3413..3418 CDD:409564
Ig strand G 3426..3429 CDD:409564
I-set 3465..3556 CDD:400151
Ig strand B 3482..3486 CDD:409353
Ig strand C 3495..3499 CDD:409353
Ig strand E 3522..3526 CDD:409353
Ig strand F 3536..3541 CDD:409353
Ig strand G 3549..3552 CDD:409353
I-set 3660..3749 CDD:400151
Ig strand B 3677..3681 CDD:409353
Ig strand C 3690..3694 CDD:409353
Ig strand E 3712..3719 CDD:409353
Ig strand F 3729..3734 CDD:409353
Ig strand G 3742..3745 CDD:409353
I-set 3820..3909 CDD:400151
Ig strand B 3837..3841 CDD:409353
Ig strand C 3850..3854 CDD:409353
Ig strand E 3875..3879 CDD:409353
Ig strand F 3889..3894 CDD:409353
I-set 3938..4028 CDD:400151
Ig strand B 3955..3959 CDD:409565
Ig strand C 3968..3972 CDD:409565
Ig strand E 3994..3998 CDD:409565
Ig strand F 4008..4013 CDD:409565
Ig strand G 4021..4024 CDD:409565
Ig 4606..4694 CDD:472250
Ig strand C 4634..4638 CDD:409353
Ig strand E 4659..4663 CDD:409353
Ig strand F 4674..4679 CDD:409353
I-set 4700..4789 CDD:400151
Ig strand B 4717..4721 CDD:409353
Ig strand C 4730..4734 CDD:409353
Ig strand E 4755..4759 CDD:409353
Ig strand F 4769..4774 CDD:409353
Ig strand G 4782..4785 CDD:409353
I-set 4795..4884 CDD:400151
Ig strand B 4812..4816 CDD:409353
Ig strand C 4825..4829 CDD:409353
Ig strand E 4850..4854 CDD:409353
Ig strand F 4864..4869 CDD:409353
Ig strand G 4877..4880 CDD:409353
I-set 4888..4977 CDD:400151
Ig strand B 4905..4909 CDD:409353
Ig strand C 4918..4922 CDD:409353
Ig strand E 4943..4947 CDD:409353
Ig strand F 4957..4962 CDD:409353
Ig strand G 4971..4974 CDD:409353
I-set 4981..5071 CDD:400151
Ig strand B 4999..5003 CDD:409353
Ig strand C 5012..5016 CDD:409353
Ig strand E 5037..5041 CDD:409353
Ig strand F 5051..5056 CDD:409353
I-set 5075..5161 CDD:400151
Ig strand B 5092..5096 CDD:409353
Ig strand C 5105..5109 CDD:409353
Ig strand E 5130..5134 CDD:409353
Ig strand F 5144..5149 CDD:409353
I-set 5168..5257 CDD:400151
Ig strand B 5185..5189 CDD:409566
Ig strand C 5198..5202 CDD:409566
Ig strand E 5223..5227 CDD:409566
Ig strand F 5237..5242 CDD:409566
Ig strand G 5250..5253 CDD:409566
I-set 5270..5350 CDD:400151
Ig strand B 5278..5282 CDD:409353
Ig strand C 5291..5295 CDD:409353
Ig strand E 5316..5320 CDD:409353
Ig strand F 5330..5335 CDD:409353
Ig strand G 5344..5347 CDD:409353
I-set 5357..5446 CDD:400151
Ig strand B 5375..5378 CDD:409353
Ig strand C 5387..5391 CDD:409353
Ig strand E 5412..5416 CDD:409353
Ig strand F 5426..5431 CDD:409353
Ig strand G 5440..5443 CDD:409353
I-set 5450..5539 CDD:400151
Ig strand B 5467..5471 CDD:409564
Ig strand C 5480..5484 CDD:409564
Ig strand E 5505..5509 CDD:409564
Ig strand F 5519..5524 CDD:409564
Ig strand G 5532..5535 CDD:409564
I-set 5545..5633 CDD:400151
Ig strand B 5562..5565 CDD:409353
Ig strand C 5574..5578 CDD:409353
Ig strand E 5599..5603 CDD:409353
Ig strand F 5613..5618 CDD:409353
Ig strand G 5627..5630 CDD:409353
I-set 5637..5725 CDD:400151
Ig strand B 5654..5658 CDD:409353
Ig strand C 5667..5671 CDD:409353
Ig strand E 5692..5696 CDD:409353
Ig strand F 5706..5711 CDD:409353
Ig 5730..5819 CDD:472250
Ig strand C 5760..5764 CDD:409353
Ig strand E 5785..5789 CDD:409353
Ig strand F 5799..5804 CDD:409353
Ig 5831..5912 CDD:472250
Ig strand B 5840..5844 CDD:409353
Ig strand C 5853..5857 CDD:409353
Ig strand E 5878..5882 CDD:409353
Ig strand F 5892..5897 CDD:409353
Ig strand G 5907..5910 CDD:409353
I-set 5919..6008 CDD:400151
Ig strand C 5949..5953 CDD:409353
Ig strand E 5974..5978 CDD:409353
Ig strand F 5988..5993 CDD:409353
I-set 6012..6101 CDD:400151
Ig strand B 6029..6033 CDD:409564
Ig strand C 6042..6046 CDD:409564
Ig strand E 6067..6071 CDD:409564
Ig strand F 6081..6086 CDD:409564
Ig strand G 6094..6097 CDD:409564
I-set 6105..6195 CDD:400151
Ig strand B 6124..6127 CDD:409353
Ig strand C 6136..6140 CDD:409353
Ig strand E 6161..6165 CDD:409353
Ig strand F 6175..6180 CDD:409353
Ig strand G 6188..6191 CDD:409353
I-set 6199..6287 CDD:400151
Ig strand B 6216..6220 CDD:409353
Ig strand C 6229..6233 CDD:409353
Ig strand E 6254..6258 CDD:409353
Ig strand F 6268..6273 CDD:409353
I-set 6292..6381 CDD:400151
Ig strand B 6309..6313 CDD:409353
Ig strand C 6322..6326 CDD:409353
Ig strand E 6347..6351 CDD:409353
Ig strand F 6361..6366 CDD:409353
I-set 6386..6474 CDD:400151
Ig strand B 6403..6406 CDD:409353
Ig strand C 6415..6419 CDD:409353
Ig strand E 6440..6444 CDD:409353
Ig strand F 6454..6459 CDD:409353
I-set 6481..6570 CDD:400151
Ig strand B 6498..6502 CDD:409564
Ig strand C 6511..6515 CDD:409564
Ig strand E 6536..6540 CDD:409564
Ig strand F 6550..6555 CDD:409564
Ig strand G 6563..6566 CDD:409564
I-set 6574..6663 CDD:400151
Ig strand B 6591..6595 CDD:409564
Ig strand C 6604..6608 CDD:409564
Ig strand E 6629..6633 CDD:409564
Ig strand F 6643..6648 CDD:409564
Ig strand G 6656..6659 CDD:409564
I-set 6667..6757 CDD:400151
Ig strand B 6686..6689 CDD:409353
Ig strand C 6698..6702 CDD:409353
Ig strand E 6723..6727 CDD:409353
Ig strand F 6737..6742 CDD:409353
I-set 6761..6849 CDD:400151
Ig strand B 6778..6782 CDD:409353
Ig strand C 6791..6795 CDD:409353
Ig strand E 6816..6820 CDD:409353
Ig strand F 6830..6835 CDD:409353
Ig 6854..6944 CDD:472250
Ig strand B 6871..6875 CDD:409353
Ig strand C 6884..6888 CDD:409353
Ig strand E 6910..6914 CDD:409353
Ig strand F 6924..6929 CDD:409353
Ig strand G 6937..6940 CDD:409353
I-set 6949..7037 CDD:400151
Ig strand B 6966..6969 CDD:409353
Ig strand C 6978..6982 CDD:409353
Ig strand E 7003..7007 CDD:409353
Ig strand F 7017..7022 CDD:409353
Ig strand G 7031..7034 CDD:409353
I-set 7044..7133 CDD:400151
Ig strand C 7074..7078 CDD:409353
Ig strand E 7099..7103 CDD:409353
Ig strand F 7113..7118 CDD:409353
Ig strand G 7127..7130 CDD:409353
I-set 7137..7226 CDD:400151
Ig strand B 7154..7158 CDD:409353
Ig strand C 7167..7171 CDD:409353
Ig strand E 7192..7196 CDD:409353
Ig strand F 7206..7211 CDD:409353
Ig strand G 7219..7222 CDD:409353
Ig 7232..7317 CDD:472250
Ig strand C 7260..7264 CDD:409353
Ig strand E 7285..7289 CDD:409353
Ig strand F 7299..7304 CDD:409353
I-set 7323..7407 CDD:400151
Ig strand B 7340..7344 CDD:409353
Ig strand C 7353..7357 CDD:409353
Ig strand E 7378..7382 CDD:409353
Ig strand F 7392..7397 CDD:409353
Ig strand G 7406..7409 CDD:409353
I-set 7419..7507 CDD:400151
Ig strand B 7436..7440 CDD:409353
Ig strand C 7449..7453 CDD:409353
Ig strand E 7474..7478 CDD:409353
Ig strand F 7488..7493 CDD:409353
I-set 7515..7604 CDD:400151
Ig strand B 7532..7536 CDD:409353
Ig strand C 7545..7549 CDD:409353
Ig strand E 7571..7574 CDD:409353
Ig strand F 7584..7589 CDD:409353
Ig strand G 7597..7600 CDD:409353
I-set 7608..7698 CDD:400151
Ig strand B 7626..7630 CDD:409564
Ig strand C 7639..7643 CDD:409564
Ig strand E 7664..7668 CDD:409564
Ig strand F 7678..7683 CDD:409564
Ig strand G 7691..7694 CDD:409564
I-set 7702..7790 CDD:400151
Ig strand B 7719..7723 CDD:409564
Ig strand C 7732..7736 CDD:409564
Ig strand E 7757..7761 CDD:409564
Ig strand F 7771..7776 CDD:409564
Ig strand C 14083..14086 CDD:409565
Ig strand E 14108..14111 CDD:409565
Ig 14143..14226 CDD:472250
Ig strand B 14159..14163 CDD:409353
Ig strand C 14171..14175 CDD:409353
Ig strand E 14196..14200 CDD:409353
Ig strand F 14210..14215 CDD:409353
Ig strand G 14219..14222 CDD:409353
Ig 14231..14314 CDD:472250
Ig strand B 14248..14252 CDD:409353
Ig strand C 14259..14263 CDD:409353
Ig strand E 14284..14288 CDD:409353
Ig strand F 14298..14303 CDD:409353
Ig strand G 14307..14310 CDD:409353
Ig 14320..14403 CDD:472250
Ig 14410..14484 CDD:472250
Ig strand B 14425..14429 CDD:409353
Ig strand C 14437..14441 CDD:409353
Ig strand E 14462..14466 CDD:409353
Ig strand F 14476..14481 CDD:409353
Ig 14498..14581 CDD:472250
Ig 14605..14665 CDD:472250
Ig strand C 14615..14619 CDD:409353
Ig strand E 14640..14644 CDD:409353
Ig strand F 14654..14659 CDD:409353
Ig 14676..14759 CDD:472250
Ig 14767..14848 CDD:472250
Ig strand B 14781..14785 CDD:409353
Ig strand C 14793..14797 CDD:409353
Ig strand E 14818..14822 CDD:409353
Ig strand F 14832..14837 CDD:409353
Ig strand G 14841..14844 CDD:409353
Ig 14854..14937 CDD:472250
Ig strand B 14870..14874 CDD:409353
Ig strand C 14882..14886 CDD:409353
Ig strand E 14907..14911 CDD:409353
Ig strand F 14921..14926 CDD:409353
Ig strand G 14930..14933 CDD:409353
Ig 14949..15026 CDD:472250
Ig strand B 14959..14963 CDD:409353
Ig strand C 14971..14975 CDD:409353
Ig strand E 14996..15000 CDD:409353
Ig strand F 15010..15015 CDD:409353
Ig strand G 15019..15022 CDD:409353
Ig 15040..15108 CDD:472250
Ig strand B 15048..15052 CDD:409353
Ig strand C 15060..15064 CDD:409353
Ig strand E 15085..15089 CDD:409353
Ig strand F 15099..15104 CDD:409353
Ig 15121..15204 CDD:472250
Ig strand B 15137..15141 CDD:409353
Ig strand C 15150..15153 CDD:409353
Ig strand E 15174..15178 CDD:409353
Ig strand G 15197..15200 CDD:409353
Ig 15210..15298 CDD:472250
Ig strand B 15225..15229 CDD:409353
Ig strand C 15237..15241 CDD:409353
Ig strand E 15262..15266 CDD:409353
Ig strand F 15276..15281 CDD:409353
Ig strand G 15290..15293 CDD:409353
Ig 15303..15386 CDD:472250
Ig strand B 15319..15323 CDD:409353
Ig strand C 15331..15335 CDD:409353
Ig strand E 15356..15360 CDD:409353
Ig strand F 15370..15375 CDD:409353
Ig strand G 15379..15382 CDD:409353
Ig 15392..15475 CDD:472250
Ig strand B 15408..15412 CDD:409353
Ig strand C 15420..15424 CDD:409353
Ig strand E 15445..15449 CDD:409353
Ig strand F 15459..15464 CDD:409353
Ig strand G 15468..15471 CDD:409353
Ig 15481..15563 CDD:472250
Ig 15577..15654 CDD:472250
Ig strand B 15585..15589 CDD:409353
Ig strand C 15598..15602 CDD:409353
Ig strand E 15620..15624 CDD:409353
Ig strand F 15634..15639 CDD:409353
Ig strand G 15647..15650 CDD:409353
FN3 15658..15746 CDD:238020
FN3 <15718..>15989 CDD:442628
FN3 15930..16421 CDD:442628
FN3 16341..>16798 CDD:442628
FN3 <16656..>16942 CDD:442628
Ig 16964..17044 CDD:472250
Ig strand B 16972..16976 CDD:409353
Ig strand C 16985..16989 CDD:409353
Ig strand E 17010..17014 CDD:409353
Ig strand F 17024..17029 CDD:409353
Ig strand G 17037..17040 CDD:409353
FN3 17048..17134 CDD:238020
FN3 17153..17240 CDD:238020
Ig 17259..17366 CDD:472250
Ig strand B 17265..17269 CDD:409353
Ig strand C 17278..17282 CDD:409353
Ig strand E 17332..17336 CDD:409353
Ig strand F 17346..17351 CDD:409353
Ig strand G 17359..17362 CDD:409353
FN3 17370..17454 CDD:214495
FN3 17471..17563 CDD:238020
FN3 17577..17663 CDD:238020
FN3 <17696..>17981 CDD:442628
FN3 17863..17955 CDD:238020
Ig 17975..18062 CDD:472250
Ig strand B 17984..17988 CDD:409353
Ig strand C 17997..18001 CDD:409353
Ig strand E 18028..18032 CDD:409353
FN3 18034..>18370 CDD:442628
Ig strand F 18042..18047 CDD:409353
Ig strand G 18055..18058 CDD:409353
Ig_Titin_like 18387..18476 CDD:409406
Ig strand A 18387..18391 CDD:409406
Ig strand B 18396..18402 CDD:409406
Ig strand C 18408..18414 CDD:409406
FN3 <18426..18822 CDD:442628
Ig strand D 18434..18439 CDD:409406
Ig strand E 18440..18446 CDD:409406
Ig strand F 18455..18463 CDD:409406
Ig strand G 18466..18476 CDD:409406
FN3 18480..18572 CDD:238020
FN3 <18835..>19127 CDD:442628
FN3 18885..18982 CDD:238020
Ig_Titin_like 19101..19180 CDD:409406
Ig strand A 19101..19105 CDD:409406
Ig strand B 19110..19116 CDD:409406
Ig strand C 19122..19128 CDD:409406
Ig strand D 19138..19143 CDD:409406
Ig strand E 19144..19150 CDD:409406
Ig strand F 19159..19167 CDD:409406
FN3 <19161..19564 CDD:442628
Ig strand G 19170..19180 CDD:409406
FN3 <19500..>19771 CDD:442628
Ig 19797..19874 CDD:472250
Ig strand B 19804..19808 CDD:409353
Ig strand C 19817..19821 CDD:409353
Ig strand E 19840..19844 CDD:409353
Ig strand F 19854..19859 CDD:409353
FN3 <19855..20231 CDD:442628
Ig strand G 19867..19870 CDD:409353
Ig 20088..20168 CDD:472250
Ig strand B 20096..20100 CDD:409353
Ig strand C 20109..20113 CDD:409353
Ig strand E 20134..20138 CDD:409353
Ig strand F 20148..20153 CDD:409353
FN3 20149..>20458 CDD:442628
Ig strand G 20161..20164 CDD:409353
Ig 20485..20566 CDD:472250
Ig strand B 20494..20498 CDD:409353
Ig strand C 20507..20511 CDD:409353
Ig strand E 20532..20536 CDD:409353
Ig strand F 20546..20551 CDD:409353
Ig strand G 20561..20564 CDD:409353
FN3 20570..20660 CDD:238020
FN3 20669..20762 CDD:238020
Ig 20769..20862 CDD:472250
Ig strand B 20787..20791 CDD:409566
Ig strand C 20800..20804 CDD:409566
Ig strand E 20827..20831 CDD:409566
Ig strand F 20841..20846 CDD:409566
Ig strand G 20854..20857 CDD:409566
FN3 20865..20947 CDD:214495
FN3 20910..21452 CDD:442628
FN3 20964..21057 CDD:238020
Ig_Titin_like 21184..21263 CDD:409406
Ig strand A 21184..21187 CDD:409406
Ig strand B 21192..21198 CDD:409406
Ig strand C 21204..21210 CDD:409406
Ig strand D 21221..21226 CDD:409406
Ig strand E 21227..21233 CDD:409406
Ig strand F 21242..21250 CDD:409406
Ig strand G 21253..21263 CDD:409406
FN3 21267..21353 CDD:238020
Ig_Titin_like 21476..21556 CDD:409406
Ig strand A 21476..21479 CDD:409406
Ig strand B 21484..21490 CDD:409406
Ig strand C 21496..21502 CDD:409406
Ig strand D 21514..21519 CDD:409406
Ig strand E 21520..21526 CDD:409406
Ig strand F 21535..21543 CDD:409406
Ig strand G 21546..21556 CDD:409406
FN3 21560..21648 CDD:238020
FN3 21660..21753 CDD:238020
FN3 21759..21853 CDD:238020
Ig 21873..21953 CDD:472250
Ig strand B 21881..21885 CDD:409353
Ig strand C 21894..21898 CDD:409353
Ig strand E 21919..21923 CDD:409353
Ig strand F 21933..21938 CDD:409353
Ig strand G 21946..21949 CDD:409353
FN3 21957..22048 CDD:238020
FN3 22056..22145 CDD:238020
FN3 22157..22245 CDD:238020
Ig_Titin_like 22270..22351 CDD:409406
Ig strand A 22270..22274 CDD:409406
Ig strand B 22279..22285 CDD:409406
Ig strand C 22291..22297 CDD:409406
Ig strand D 22309..22314 CDD:409406
Ig strand E 22315..22321 CDD:409406
Ig strand F 22330..22338 CDD:409406
Ig strand G 22341..22351 CDD:409406
FN3 22355..22446 CDD:238020
FN3 22452..22540 CDD:238020
Ig_Titin_like 22559..22640 CDD:409406
Ig strand A 22559..22563 CDD:409406
Ig strand B 22568..22574 CDD:409406
Ig strand C 22580..22586 CDD:409406
FN3 22588..23075 CDD:442628
Ig strand D 22598..22603 CDD:409406
Ig strand E 22604..22610 CDD:409406
Ig strand F 22619..22627 CDD:409406
Ig strand G 22630..22640 CDD:409406
FN3 22938..23453 CDD:442628
Ig_Titin_like 23353..23432 CDD:409406
Ig strand A 23353..23357 CDD:409406
Ig strand B 23362..23368 CDD:409406
Ig strand C 23374..23380 CDD:409406
Ig strand D 23390..23395 CDD:409406
Ig strand E 23396..23402 CDD:409406
Ig strand F 23411..23419 CDD:409406
Ig strand G 23422..23432 CDD:409406
FN3 23436..23525 CDD:238020
FN3 23533..23624 CDD:238020
Ig_Titin_like 23643..23723 CDD:409406
Ig strand A 23643..23646 CDD:409406
Ig strand B 23651..23657 CDD:409406
Ig strand C 23663..23669 CDD:409406
Ig strand D 23681..23686 CDD:409406
Ig strand E 23687..23693 CDD:409406
Ig strand F 23702..23710 CDD:409406
Ig strand G 23713..23723 CDD:409406
FN3 <23736..>24019 CDD:442628
Ig 24038..24119 CDD:472250
Ig strand B 24047..24051 CDD:409353
Ig strand C 24060..24064 CDD:409353
Ig strand E 24085..24089 CDD:409353
Ig strand F 24099..24104 CDD:409353
Ig strand G 24112..24115 CDD:409353
FN3 <24165..>24411 CDD:442628
Ig_Titin_like 24437..24516 CDD:409406
Ig strand A 24437..24441 CDD:409406
Ig strand B 24446..24452 CDD:409406
Ig strand C 24458..24464 CDD:409406
Ig strand D 24474..24479 CDD:409406
Ig strand E 24480..24486 CDD:409406
Ig strand F 24495..24503 CDD:409406
Ig strand G 24506..24516 CDD:409406
FN3 24520..24609 CDD:238020
FN3 24617..24700 CDD:238020
Ig_Titin_like 24724..24805 CDD:409406
Ig strand A 24724..24728 CDD:409406
Ig strand B 24733..24739 CDD:409406
Ig strand C 24745..24751 CDD:409406
Ig strand D 24763..24768 CDD:409406
Ig strand E 24769..24775 CDD:409406
Ig strand F 24784..24792 CDD:409406
FN3 <24785..25192 CDD:442628
Ig strand G 24795..24805 CDD:409406
Ig_Titin_like 25120..25201 CDD:409406
Ig strand A 25120..25124 CDD:409406
Ig strand B 25129..25135 CDD:409406
Ig strand C 25141..25147 CDD:409406
Ig strand D 25159..25164 CDD:409406
FN3 25162..25684 CDD:442628
Ig strand E 25165..25171 CDD:409406
Ig strand F 25180..25188 CDD:409406
Ig strand G 25191..25201 CDD:409406
FN3 25305..25394 CDD:238020
Ig_Titin_like 25520..25598 CDD:409406
Ig strand A 25520..25523 CDD:409406
Ig strand B 25528..25534 CDD:409406
Ig strand C 25540..25546 CDD:409406
Ig strand D 25556..25561 CDD:409406
Ig strand E 25562..25568 CDD:409406
Ig strand F 25577..25585 CDD:409406
Ig strand G 25588..25598 CDD:409406
FN3 25699..25782 CDD:238020
Ig_Titin_like 25807..25885 CDD:409406
Ig strand A 25807..25810 CDD:409406
Ig strand B 25815..25821 CDD:409406
Ig strand C 25827..25833 CDD:409406
FN3 25840..>26177 CDD:442628
Ig strand D 25845..25850 CDD:409406
Ig strand E 25851..25857 CDD:409406
Ig strand F 25866..25874 CDD:409406
Ig strand G 25877..25885 CDD:409406
Ig 26202..26283 CDD:472250
Ig strand B 26211..26215 CDD:409353
Ig strand C 26224..26228 CDD:409353
Ig strand E 26249..26253 CDD:409353
FN3 <26263..26586 CDD:442628
Ig strand F 26263..26268 CDD:409353
Ig strand G 26276..26279 CDD:409353
FN3 26387..26477 CDD:238020
Ig_Titin_like 26602..26680 CDD:409406
Ig strand A 26602..26605 CDD:409406
Ig strand B 26610..26616 CDD:409406
Ig strand C 26622..26628 CDD:409406
Ig strand D 26638..26643 CDD:409406
Ig strand E 26644..26650 CDD:409406
Ig strand F 26659..26667 CDD:409406
FN3 <26667..27028 CDD:442628
Ig strand G 26670..26680 CDD:409406
Ig_Titin_like 26888..26969 CDD:409406
Ig strand A 26888..26892 CDD:409406
Ig strand B 26897..26903 CDD:409406
Ig strand C 26909..26915 CDD:409406
FN3 26923..>27266 CDD:442628
Ig strand D 26927..26932 CDD:409406
Ig strand E 26933..26939 CDD:409406
Ig strand F 26948..26956 CDD:409406
Ig strand G 26959..26969 CDD:409406
Ig 27284..27366 CDD:472250
Ig strand B 27293..27297 CDD:409353
Ig strand C 27306..27310 CDD:409353
Ig strand E 27332..27336 CDD:409353
Ig strand F 27346..27351 CDD:409353
Ig strand G 27359..27362 CDD:409353
FN3 <27412..>27666 CDD:442628
Ig_Titin_like 27684..27763 CDD:409406
Ig strand A 27684..27688 CDD:409406
Ig strand B 27693..27699 CDD:409406
Ig strand C 27705..27711 CDD:409406
Ig strand D 27721..27726 CDD:409406
Ig strand E 27727..27733 CDD:409406
Ig strand F 27742..27750 CDD:409406
Ig strand G 27753..27763 CDD:409406
FN3 27767..27856 CDD:238020
FN3 27864..27947 CDD:238020
FN3 27924..28465 CDD:442628
Ig_Titin_like 27971..28052 CDD:409406
Ig strand A 27971..27975 CDD:409406
Ig strand B 27980..27986 CDD:409406
Ig strand C 27992..27998 CDD:409406
Ig strand D 28010..28015 CDD:409406
Ig strand E 28016..28022 CDD:409406
Ig strand F 28031..28039 CDD:409406
Ig strand G 28042..28052 CDD:409406
Ig_Titin_like 28366..28447 CDD:409406
Ig strand A 28366..28370 CDD:409406
Ig strand B 28375..28381 CDD:409406
Ig strand C 28387..28393 CDD:409406
Ig strand D 28405..28410 CDD:409406
Ig strand E 28411..28417 CDD:409406
Ig strand F 28426..28434 CDD:409406
Ig strand G 28437..28447 CDD:409406
FN3 28451..28543 CDD:238020
FN3 <28518..28875 CDD:442628
Ig_Titin_like 28763..28842 CDD:409406
Ig strand A 28763..28767 CDD:409406
Ig strand B 28772..28778 CDD:409406
Ig strand C 28784..28790 CDD:409406
Ig strand D 28800..28805 CDD:409406
Ig strand E 28806..28812 CDD:409406
Ig strand F 28821..28829 CDD:409406
Ig strand G 28832..28842 CDD:409406
FN3 28846..28937 CDD:238020
FN3 28943..29026 CDD:238020
Ig_Titin_like 29053..29134 CDD:409406
Ig strand A 29053..29057 CDD:409406
FN3 <29054..29508 CDD:442628
Ig strand B 29062..29068 CDD:409406
Ig strand C 29074..29080 CDD:409406
Ig strand D 29092..29097 CDD:409406
Ig strand E 29098..29104 CDD:409406
Ig strand F 29113..29121 CDD:409406
Ig strand G 29124..29134 CDD:409406
Ig_Titin_like 29449..29530 CDD:409406
Ig strand A 29449..29453 CDD:409406
Ig strand B 29458..29464 CDD:409406
Ig strand C 29470..29476 CDD:409406
Ig strand D 29488..29493 CDD:409406
Ig strand E 29494..29500 CDD:409406
Ig strand F 29509..29517 CDD:409406
Ig strand G 29520..29530 CDD:409406
FN3 29534..29626 CDD:238020
FN3 <29593..29984 CDD:442628
Ig_Titin_like 29849..29930 CDD:409406
Ig strand A 29849..29852 CDD:409406
Ig strand B 29857..29863 CDD:409406
Ig strand C 29869..29875 CDD:409406
Ig strand D 29887..29892 CDD:409406
Ig strand E 29893..29899 CDD:409406
Ig strand F 29908..29916 CDD:409406
Ig strand G 29919..29930 CDD:409406
FN3 30031..30122 CDD:238020
Ig_3 30136..30208 CDD:464046
FN3 <30175..30506 CDD:442628
Ig 30536..30616 CDD:472250
Ig strand B 30544..30548 CDD:409353
Ig strand C 30557..30561 CDD:409353
Ig strand E 30582..30586 CDD:409353
Ig strand F 30596..30601 CDD:409353
Ig strand G 30609..30612 CDD:409353
FN3 30627..30712 CDD:238020
FN3 <30675..31053 CDD:442628
Ig_Titin_like 30934..31013 CDD:409406
Ig strand A 30934..30938 CDD:409406
Ig strand B 30943..30949 CDD:409406
Ig strand C 30955..30961 CDD:409406
Ig strand D 30971..30976 CDD:409406
Ig strand E 30977..30983 CDD:409406
Ig strand F 30992..31000 CDD:409406
Ig strand G 31003..31013 CDD:409406
FN3 31017..31101 CDD:238020
FN3 31114..31197 CDD:238020
Ig_Titin_like 31225..31305 CDD:409406
Ig strand A 31225..31228 CDD:409406
Ig strand B 31233..31239 CDD:409406
Ig strand C 31245..31251 CDD:409406
FN3 31259..31721 CDD:442628
Ig strand D 31263..31268 CDD:409406
Ig strand E 31269..31275 CDD:409406
Ig strand F 31284..31292 CDD:409406
Ig strand G 31295..31305 CDD:409406
FN3 31709..31791 CDD:214495
FN3 <31764..32142 CDD:442628
Ig_Titin_like 32023..32102 CDD:409406
Ig strand A 32023..32027 CDD:409406
Ig strand B 32032..32038 CDD:409406
Ig strand C 32044..32050 CDD:409406
Ig strand D 32060..32065 CDD:409406
Ig strand E 32066..32072 CDD:409406
Ig strand F 32081..32089 CDD:409406
Ig strand G 32092..32102 CDD:409406
FN3 32106..32197 CDD:238020
FN3 32203..32296 CDD:238020
Ig_Titin_like 32315..32396 CDD:409406
Ig strand A 32315..32319 CDD:409406
Ig strand B 32324..32330 CDD:409406
Ig strand C 32336..32342 CDD:409406
Ig strand D 32354..32359 CDD:409406
FN3 32357..>32696 CDD:442628
Ig strand E 32360..32366 CDD:409406
Ig strand F 32375..32383 CDD:409406
Ig strand G 32386..32396 CDD:409406
Ig_Titin_like 32714..32792 CDD:409406
Ig strand A 32714..32717 CDD:409406
Ig strand B 32722..32728 CDD:409406
Ig strand C 32734..32740 CDD:409406
Ig strand D 32750..32755 CDD:409406
Ig strand E 32756..32762 CDD:409406
Ig strand F 32771..32779 CDD:409406
Ig strand G 32782..32792 CDD:409406
FN3 <32796..>32990 CDD:442628
FN3 32999..33084 CDD:238020
I-set 33101..33188 CDD:400151
Ig strand B 33118..33122 CDD:409564
Ig strand C 33131..33135 CDD:409564
Ig strand E 33156..33160 CDD:409564
Ig strand F 33170..33175 CDD:409564
Ig strand G 33183..33186 CDD:409564
Ig 33210..33285 CDD:472250
Ig strand B 33214..33218 CDD:409353
Ig strand C 33227..33231 CDD:409353
Ig strand E 33252..33256 CDD:409353
Ig strand F 33267..33272 CDD:409353
Ig strand G 33280..33283 CDD:409353
FN3 33291..33384 CDD:238020
FN3 33393..33486 CDD:238020
Ig 33496..33588 CDD:472250
Ig strand B 33513..33517 CDD:409353
Ig strand C 33526..33530 CDD:409353
Ig strand E 33553..33557 CDD:409353
Ig strand F 33567..33572 CDD:409353
Ig strand G 33580..33583 CDD:409353
Ig_Titin_like 33605..33686 CDD:409406
Ig strand A 33605..33608 CDD:409406
Ig strand B 33613..33619 CDD:409406
Ig strand C 33625..33631 CDD:409406
Ig strand D 33643..33648 CDD:409406
Ig strand E 33649..33655 CDD:409406
Ig strand F 33665..33673 CDD:409406
Ig strand G 33676..33686 CDD:409406
FN3 33690..33780 CDD:238020
STKc_Titin 33818..34094 CDD:271006 90/327 (28%)
IgI_Titin_M1-like 34137..34226 CDD:409521 11/92 (12%)
Ig strand A 34138..34141 CDD:409521 1/2 (50%)
Ig strand A' 34144..34147 CDD:409521 1/6 (17%)
Ig strand B 34151..34160 CDD:409521 3/8 (38%)
Ig strand C 34166..34172 CDD:409521 2/5 (40%)
Ig strand C' 34174..34177 CDD:409521 1/2 (50%)
Ig strand D 34183..34188 CDD:409521 0/4 (0%)
Ig strand E 34192..34198 CDD:409521 0/5 (0%)
Ig strand F 34205..34213 CDD:409521 0/7 (0%)
Ig strand G 34216..34225 CDD:409521 1/8 (13%)
I-set 34258..34350 CDD:400151 22/94 (23%)
Ig strand B 34275..34279 CDD:409353 0/3 (0%)
Ig strand C 34288..34292 CDD:409353 1/3 (33%)
Ig strand E 34316..34320 CDD:409353 2/3 (67%)
Ig strand F 34330..34335 CDD:409353 0/4 (0%)
Ig strand G 34343..34346 CDD:409353 0/2 (0%)
I-set 34363..34453 CDD:400151 17/101 (17%)
Ig strand B 34380..34384 CDD:409564 1/3 (33%)
Ig strand C 34393..34397 CDD:409564 0/3 (0%)
Ig strand E 34419..34423 CDD:409564 0/3 (0%)
Ig strand F 34433..34438 CDD:409564 1/4 (25%)
Ig strand G 34446..34449 CDD:409564 1/2 (50%)
Ig 34942..35031 CDD:472250
Ig strand B 34959..34963 CDD:409353
Ig strand C 34972..34976 CDD:409353
Ig strand E 34997..35001 CDD:409353
Ig strand F 35011..35016 CDD:409353
Ig strand G 35024..35027 CDD:409353
IgI_Titin_like 35126..35217 CDD:143224
Ig strand A 35128..35135 CDD:143224
Ig strand A' 35136..35141 CDD:143224
Ig strand B 35146..35154 CDD:143224
Ig strand C 35158..35164 CDD:143224
Ig strand C' 35166..35168 CDD:143224
Ig strand D 35174..35180 CDD:143224
Ig strand E 35183..35189 CDD:143224
Ig strand F 35198..35205 CDD:143224
Ig strand G 35208..35217 CDD:143224
Ig 35286..35373 CDD:472250
Ig strand B 35301..35305 CDD:409353
Ig strand C 35316..35320 CDD:409353
Ig strand E 35342..35346 CDD:409353
Ig strand F 35356..35361 CDD:409353
I-set 35420..35509 CDD:400151
Ig strand C 35450..35454 CDD:143223
Ig strand E 35472..35479 CDD:143223
Ig strand F 35489..35494 CDD:143223
Ig strand G 35503..35506 CDD:143223
Ig 35616..35688 CDD:472250
Ig strand B 35624..35628 CDD:409353
Ig strand C 35635..35639 CDD:409353
Ig strand E 35660..35664 CDD:409353
I-set 35702..35791 CDD:400151
Ig strand B 35719..35723 CDD:409353
Ig strand C 35732..35736 CDD:409353
Ig strand E 35757..35761 CDD:409353
Ig strand F 35771..35776 CDD:409353
Ig strand G 35784..35787 CDD:409353
I-set 35897..35988 CDD:400151
Ig strand B 35914..35918 CDD:409353
Ig strand C 35927..35931 CDD:409353
Ig strand E 35954..35958 CDD:409353
Ig strand F 35968..35973 CDD:409353
Ig strand G 35981..35984 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.