DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and MYLK

DIOPT Version :10

Sequence 1:NP_996411.2 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:XP_024309300.1 Gene:MYLK / 4638 HGNCID:7590 Length:1924 Species:Homo sapiens


Alignment Length:399 Identity:120/399 - (30%)
Similarity:198/399 - (49%) Gaps:55/399 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 INEIYEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKE-IKHEIAVLMLCEGED 95
            :::.|::|:. ...|||..|.|.:.|.|...:|.||.|   ...:.:|| |:.||:: |.|....
Human  1470 VSDFYDIEER-LGSGKFGQVFRLVEKKTRKVWAGKFFK---AYSAKEKENIRQEISI-MNCLHHP 1529

  Fly    96 NIVNLNAVHETRSDTALLLELATGGEL-QTILDNEECLTEAQARHCMREVLKALKFLHDRSIAHL 159
            .:|......|.:::..::||:.:|||| :.|:|.:..|||.:....||::.:.::::|.:.|.||
Human  1530 KLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHL 1594

  Fly   160 DLKPQNILL---AGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIW 221
            ||||:||:.   .|.||    ||.|||::|.:....:::.:.|||::|||||:.|||:...||:|
Human  1595 DLKPENIMCVNKTGTRI----KLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMW 1655

  Fly   222 SVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNA 286
            |:||:.|:|:||.|||.||...||..|::.....|.|..|..:|..|.|||...|:....:|::.
Human  1656 SIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDC 1720

  Fly   287 TGCLDHIWLKDDCSLDRQIYLQPQSDAEEEEEEDVDDDVEDEEEEEQVEEEEEETQNVEEPTTEA 351
            |.||.|.||              ..|.:..|.:.:.   :|..::.....:.::|.|.       
Human  1721 TQCLQHPWL--------------MKDTKNMEAKKLS---KDRMKKYMARRKWQKTGNA------- 1761

  Fly   352 PQQQQQPVQQHQLAKSGQIHSKPTHNG-HHRANSGGSISKIPIATSKLQSTPSSETTTAIHTLTS 415
                        :...|::.|....:| ..|.:|.||.:. |:...||:|  ..:.:.|.....:
Human  1762 ------------VRAIGRLSSMAMISGLSGRKSSTGSPTS-PLNAEKLES--EEDVSQAFLEAVA 1811

  Fly   416 NSNGHVHKP 424
            ....|| ||
Human  1812 EEKPHV-KP 1819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_996411.2 STKc_DRAK 28..295 CDD:271008 97/267 (36%)
PHA03255 379..>554 CDD:165513 13/46 (28%)
MYLKXP_024309300.1 I-set 43..133 CDD:400151
Ig strand B 60..64 CDD:409353
Ig strand C 73..77 CDD:409353
Ig strand E 99..103 CDD:409353
Ig strand F 113..118 CDD:409353
Ig strand G 126..129 CDD:409353
I-set 171..260 CDD:400151
Ig strand B 188..192 CDD:409353
Ig strand C 201..205 CDD:409353
Ig strand E 226..230 CDD:409353
Ig strand F 240..245 CDD:409353
Ig strand G 253..256 CDD:409353
23ISL 261..422 CDD:435470
I-set 424..514 CDD:400151
Ig strand B 441..445 CDD:409543
Ig strand C 454..458 CDD:409543
Ig strand E 480..484 CDD:409543
Ig strand F 494..499 CDD:409543
Ig strand G 507..510 CDD:409543
IgI_4_MYLK-like 523..610 CDD:409568
Ig strand A 523..526 CDD:409568
Ig strand A' 532..535 CDD:409568
Ig strand B 540..548 CDD:409568
Ig strand C 554..558 CDD:409568
Ig strand C' 561..564 CDD:409568
Ig strand D 568..572 CDD:409568
Ig strand E 576..581 CDD:409568
Ig strand F 589..597 CDD:409568
Ig strand G 600..610 CDD:409568
IgI_4_hemolin-like 633..722 CDD:409570
Ig strand A 633..636 CDD:409570
Ig strand A' 642..645 CDD:409570
Ig strand B 650..657 CDD:409570
Ig strand C 663..668 CDD:409570
Ig strand C' 671..673 CDD:409570
Ig strand D 678..682 CDD:409570
Ig strand E 688..692 CDD:409570
Ig strand F 701..709 CDD:409570
Ig strand G 712..722 CDD:409570
I-set 731..819 CDD:400151
Ig strand B 748..752 CDD:409353
Ig strand C 761..765 CDD:409353
Ig strand E 787..791 CDD:409353
Ig strand F 801..806 CDD:409353
Ig strand G 814..817 CDD:409353
I-set 1108..1197 CDD:400151
Ig strand B 1125..1129 CDD:409353
Ig strand C 1138..1142 CDD:409353
Ig strand E 1163..1167 CDD:409353
Ig strand F 1177..1182 CDD:409353
Ig strand G 1190..1193 CDD:409353
IgI_8_hMLCK_like 1247..1345 CDD:409419
Ig strand A 1247..1251 CDD:409419
Ig strand A' 1256..1260 CDD:409419
Ig strand B 1264..1273 CDD:409419
Ig strand C 1277..1283 CDD:409419
Ig strand C' 1286..1288 CDD:409419
Ig strand D 1294..1299 CDD:409419
Ig strand E 1303..1308 CDD:409419
Ig strand F 1316..1324 CDD:409419
Ig strand G 1327..1337 CDD:409419
FN3 1341..1433 CDD:238020
STKc_MLCK1 1471..1729 CDD:271093 97/266 (36%)
IgI_telokin-like 1822..1909 CDD:409565
Ig strand A 1822..1825 CDD:409565
Ig strand A' 1827..1830 CDD:409565
Ig strand B 1834..1843 CDD:409565
Ig strand C 1848..1854 CDD:409565
Ig strand C' 1857..1859 CDD:409565
Ig strand D 1865..1870 CDD:409565
Ig strand E 1873..1881 CDD:409565
Ig strand F 1889..1896 CDD:409565
Ig strand G 1899..1909 CDD:409565
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.