DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and Camk1d

DIOPT Version :9

Sequence 1:NP_001162723.1 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001100835.1 Gene:Camk1d / 307124 RGDID:1560691 Length:385 Species:Rattus norvegicus


Alignment Length:276 Identity:96/276 - (34%)
Similarity:148/276 - (53%) Gaps:3/276 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DINEIYEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKEIKHEIAVLMLCEGED 95
            ||.:|:|.::| ...|.|:.|..|..|.||..||.|.:. ::..:..:..|::|||||...:.| 
  Rat    18 DIKKIFEFKET-LGTGAFSEVVLAEEKATGKLFAVKCIP-KKALKGKESSIENEIAVLRKIKHE- 79

  Fly    96 NIVNLNAVHETRSDTALLLELATGGELQTILDNEECLTEAQARHCMREVLKALKFLHDRSIAHLD 160
            |||.|..::|:.:...|:::|.:||||...:..:...||..|...:|:||.|:.:||...|.|.|
  Rat    80 NIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRD 144

  Fly   161 LKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGV 225
            |||:|:|...:..|..:.:.|||:|::..:|..:....|||.|||||||..:|.|...|.||:||
  Rat   145 LKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGV 209

  Fly   226 LTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNATGCL 290
            :.|:||.|:.||..:...:.|..|.:....|....:..:|..|.||||..:...||.|.......
  Rat   210 IAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAA 274

  Fly   291 DHIWLKDDCSLDRQIY 306
            .|.|:..|.:|.:.|:
  Rat   275 RHPWIAGDTALSKNIH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_001162723.1 STKc_DRAK 28..295 CDD:271008 92/263 (35%)
S_TKc 45..295 CDD:214567 87/249 (35%)
PHA03255 379..>554 CDD:165513
Camk1dNP_001100835.1 STKc_CaMKI_delta 12..312 CDD:271070 96/276 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.