DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and Dapk1

DIOPT Version :9

Sequence 1:NP_001162723.1 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:XP_008769663.1 Gene:Dapk1 / 306722 RGDID:1311629 Length:1442 Species:Rattus norvegicus


Alignment Length:293 Identity:114/293 - (38%)
Similarity:174/293 - (59%) Gaps:10/293 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DINEIYEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQS----SDKEIKHEIAVLMLC 91
            ::::.|:..: ....|:||.|::...|:||..:||||:|:||...|    |.::|:.|:::|...
  Rat     8 NVDDYYDTGE-ELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEI 71

  Fly    92 EGEDNIVNLNAVHETRSDTALLLELATGGELQTILDNEECLTEAQARHCMREVLKALKFLHDRSI 156
            . ..|::.|:.|:|.::|..|:|||..||||...|..:|.|||.:|...::::|..:.:||...|
  Rat    72 R-HPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILSGVYYLHSLQI 135

  Fly   157 AHLDLKPQNILLAGERI-EDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDI 220
            ||.||||:||:|....: :..:|:.|||::..:..|...:.:.|||::||||::.||||.|..|:
  Rat   136 AHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADM 200

  Fly   221 WSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMN 285
            ||:||:||:||||.|||.|||||||..|:|.....|.:..|...|.:|.|||||.|...|..||.
  Rat   201 WSIGVITYILLSGASPFLGDTKQETLANVSAVNYDFEEEFFRNTSTLAKDFIRRLLVKDPKKRMT 265

  Fly   286 ATGCLDHIWLKDDCSLDRQIYLQPQSDAEEEEE 318
            ....|.|.|:|..   |.|..|..::.|...|:
  Rat   266 IQDSLQHPWIKPK---DTQQALSRKASAVNMEK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_001162723.1 STKc_DRAK 28..295 CDD:271008 107/268 (40%)
S_TKc 45..295 CDD:214567 106/254 (42%)
PHA03255 379..>554 CDD:165513
Dapk1XP_008769663.1 STKc_DAPK1 7..275 CDD:271096 107/268 (40%)
S_TKc 13..275 CDD:214567 107/263 (41%)
Ank_2 <337..409 CDD:289560
ANK 373..497 CDD:238125
ANK repeat 378..409 CDD:293786
Ank_2 383..475 CDD:289560
ANK repeat 412..442 CDD:293786
ANK 439..564 CDD:238125
ANK repeat 444..475 CDD:293786
Ank_2 449..541 CDD:289560
ANK repeat 477..508 CDD:293786
ANK 505..629 CDD:238125
ANK repeat 510..541 CDD:293786
ANK repeat 543..574 CDD:293786
Ank_2 548..638 CDD:289560
ANK repeat 576..607 CDD:293786
ANK repeat 609..638 CDD:293786
Death_DAPK1 1308..1393 CDD:260052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2415
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44921
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.