DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and Mylk3

DIOPT Version :9

Sequence 1:NP_001162723.1 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001104280.1 Gene:Mylk3 / 291926 RGDID:1305801 Length:786 Species:Rattus norvegicus


Alignment Length:295 Identity:107/295 - (36%)
Similarity:157/295 - (53%) Gaps:16/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LVSCPD--INEIYEVEQ-TPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKEIKHEIAV 87
            :||..|  |:..|.|.| .....|:|..|.|...::||...|||.:|.:......|  :|:||.:
  Rat   468 VVSIKDTLISTSYTVSQHEVLGGGRFGQVHRCTERSTGLALAAKIIKVKNIKDRED--VKNEINI 530

  Fly    88 LMLCEGEDNIVNLNAVHETRSDTALLLELATGGEL-QTILDNEECLTEAQARHCMREVLKALKFL 151
            :... ...|::.|....|:::...|::|...|||| ..|.|.:..|||.......|::.:.:.:|
  Rat   531 MNQL-SHVNLIQLYDAFESKNSFTLIMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYL 594

  Fly   152 HDRSIAHLDLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSL 216
            |...|.||||||:|||...:.... :|:.|||::|.......::...|||:::||||:.||.:|.
  Rat   595 HQHYILHLDLKPENILCVSQTGHQ-IKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSF 658

  Fly   217 LTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPN 281
            .||:|||||:||:||||.|||.|:|..||...|..|:..|..:.|.|:|..|.||:.|.|..:.:
  Rat   659 PTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFKGLSEEAKDFVSRLLVKEKS 723

  Fly   282 DRMNATGCLDHIWLK--------DDCSLDRQIYLQ 308
            .||:||.||.|.||.        .:..|..|:.||
  Rat   724 CRMSATQCLKHEWLNHLIAKASGSNVRLRSQLLLQ 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_001162723.1 STKc_DRAK 28..295 CDD:271008 100/270 (37%)
S_TKc 45..295 CDD:214567 94/250 (38%)
PHA03255 379..>554 CDD:165513
Mylk3NP_001104280.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..258
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..315
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..443
STKc_MLCK3 477..737 CDD:271094 97/263 (37%)
S_TKc 485..737 CDD:214567 94/255 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.