DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and Mylk

DIOPT Version :10

Sequence 1:NP_996411.2 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001099344.2 Gene:Mylk / 288057 RGDID:1310915 Length:1961 Species:Rattus norvegicus


Alignment Length:399 Identity:122/399 - (30%)
Similarity:200/399 - (50%) Gaps:55/399 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 INEIYEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKE-IKHEIAVLMLCEGED 95
            ::::|::|:. ...|||..|.|.:.|.||..:|.||.|   ...:.:|| |:.||:: |.|....
  Rat  1503 VSDVYDIEER-LGSGKFGQVFRLVEKRTGKIWAGKFFK---AYSAKEKENIRQEISI-MNCLHHP 1562

  Fly    96 NIVNLNAVHETRSDTALLLELATGGEL-QTILDNEECLTEAQARHCMREVLKALKFLHDRSIAHL 159
            .:|......|.:::..::||:.:|||| :.|:|.:..|||.:....||::.:.::::|.:.|.||
  Rat  1563 KLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHL 1627

  Fly   160 DLKPQNILL---AGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIW 221
            ||||:||:.   .|.||    ||.|||::|.:....:::.:.|||::|||||:.|||:...||:|
  Rat  1628 DLKPENIMCVNKTGTRI----KLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMW 1688

  Fly   222 SVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNA 286
            |:||:.|:|:||.|||.||...||..|::.....|.|..|..:|..|.|||...|:....:|::.
  Rat  1689 SIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISEDAKDFISNLLKKDMKNRLDC 1753

  Fly   287 TGCLDHIWLKDDCSLDRQIYLQPQSDAEEEEEEDVDDDVEDEEEEEQVEEEEEETQNVEEPTTEA 351
            |.||.|.||              ..|.:..|.:.:.   :|..::.....:.::|.|.       
  Rat  1754 TQCLQHPWL--------------MKDTKNMEAKKLS---KDRMKKYMARRKWQKTGNA------- 1794

  Fly   352 PQQQQQPVQQHQLAKSGQIHSKPTHNG-HHRANSGGSISKIPIATSKLQSTPSSETTTAIHTLTS 415
                        :...|::.|....:| ..|.:|.||.:. ||...||:|  ..:.:.|.....:
  Rat  1795 ------------VRAIGRLSSMAMISGLSGRKSSTGSPTS-PINAEKLES--EEDVSQAFLEAVA 1844

  Fly   416 NSNGHVHKP 424
            ....|| ||
  Rat  1845 EEKPHV-KP 1852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_996411.2 STKc_DRAK 28..295 CDD:271008 98/267 (37%)
PHA03255 379..>554 CDD:165513 14/46 (30%)
MylkNP_001099344.2 I-set 42..132 CDD:400151
Ig strand B 59..63 CDD:409353
Ig strand C 72..76 CDD:409353
Ig strand E 93..102 CDD:409353
Ig strand F 112..117 CDD:409353
Ig strand G 125..128 CDD:409353
I-set 165..254 CDD:400151
Ig strand B 182..186 CDD:409405
Ig strand C 195..199 CDD:409405
Ig strand E 220..224 CDD:409405
Ig strand F 234..239 CDD:409405
Ig strand G 247..250 CDD:409405
23ISL 255..408 CDD:435470
I-set 410..500 CDD:400151
Ig strand B 427..431 CDD:409405
Ig strand C 440..444 CDD:409405
Ig strand E 466..470 CDD:409405
Ig strand F 480..485 CDD:409405
Ig strand G 493..496 CDD:409405
IgI_4_MYLK-like 509..596 CDD:409568
Ig strand A 509..512 CDD:409568
Ig strand A' 518..521 CDD:409568
Ig strand B 526..534 CDD:409568
Ig strand C 540..544 CDD:409568
Ig strand C' 547..550 CDD:409568
Ig strand D 554..558 CDD:409568
Ig strand E 562..567 CDD:409568
Ig strand F 575..583 CDD:409568
Ig strand G 586..596 CDD:409568
Ig 619..708 CDD:472250
Ig strand B 636..640 CDD:409353
Ig strand C 649..653 CDD:409353
Ig strand E 674..678 CDD:409353
Ig strand F 688..693 CDD:409353
Ig strand G 701..704 CDD:409353
I-set 717..805 CDD:400151
Ig strand B 734..738 CDD:409405
Ig strand C 747..751 CDD:409405
Ig strand E 773..777 CDD:409405
Ig strand F 787..792 CDD:409405
Ig strand G 800..803 CDD:409405
I-set 1141..1230 CDD:400151
Ig strand B 1158..1162 CDD:409353
Ig strand C 1171..1175 CDD:409353
Ig strand E 1196..1200 CDD:409353
Ig strand F 1210..1215 CDD:409353
Ig strand G 1223..1226 CDD:409353
IgI_8_hMLCK_like 1280..1378 CDD:409419
Ig strand A 1280..1284 CDD:409419
Ig strand A' 1289..1293 CDD:409419
Ig strand B 1297..1306 CDD:409419
Ig strand C 1310..1316 CDD:409419
Ig strand C' 1319..1321 CDD:409419
Ig strand D 1327..1332 CDD:409419
Ig strand E 1336..1341 CDD:409419
Ig strand F 1349..1357 CDD:409419
Ig strand G 1360..1370 CDD:409419
FN3 1374..1465 CDD:238020
STKc_MLCK1 1504..1762 CDD:271093 98/266 (37%)
IgI_telokin-like 1855..1942 CDD:409565
Ig strand A 1855..1858 CDD:409565
Ig strand A' 1860..1863 CDD:409565
Ig strand B 1867..1876 CDD:409565
Ig strand C 1881..1887 CDD:409565
Ig strand C' 1890..1892 CDD:409565
Ig strand D 1898..1903 CDD:409565
Ig strand E 1906..1914 CDD:409565
Ig strand F 1922..1929 CDD:409565
Ig strand G 1932..1942 CDD:409565
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.