DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Drak and Ttn

DIOPT Version :10

Sequence 1:	NP_996411.2	Gene:	Drak / 32097	FlyBaseID:	FBgn0052666	Length:	674	Species:	Drosophila melanogaster
Sequence 2:	NP_001372637.1	Gene:	Ttn / 22138	MGIID:	98864	Length:	35463	Species:	Mus musculus

Alignment Length:	731	Identity:	154/731 - (21%)
Similarity:	275/731 - (37%)	Gaps:	184/731 - (25%)

- Green bases have known domain annotations that are detailed below.

Fly 34 EIYE--VEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKE-IKHEIAVLMLCEGED 95
|:|| :......||:|..|.|.:..::...|.|||:| .:.:|:. :|.||::|.:.. ..
Mouse 33233 ELYEKYMIAEDLGRGEFGIVHRCVETSSKRTFMAKFVK----VKGTDQVLVKKEISILNIAR-HR 33292

Fly 96 NIVNLNAVHETRSDTALLLELATGGEL-QTILDNEECLTEAQARHCMREVLKALKFLHDRSIAHL 159
||:.|:...|:..:..::.|..:|.:: :.|..:...|.|.:....:|:|.:||:|||.::|.|.
Mouse 33293 NILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVRQVCEALEFLHSQNIGHF 33357

Fly 160 DLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVG 224
|::|:||:.. .|....:|:.:||.:|.:..|.|.|.:...|:|.||||.|::.:|..||:||:|
Mouse 33358 DIRPENIIYQ-TRKNSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLG 33421

Fly 225 VLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNATGC 289
.|.||||||.:||..:|.|:...||.....||.:..|..:|..|:||:.|.|..:...||.|:..
Mouse 33422 TLVYVLLSGINPFLAETNQQMIENIMNAEYTFDEEAFKEISLEAMDFVDRLLVKERKSRMTASEA 33486

Fly 290 LDHIWLKDDCSLDRQIYLQPQSDAEEEEEEDVDDDVEDEEEEEQVEEEEEETQNVEEPTTEAPQQ 354
|.|.||| |.::..:|:..:.
Mouse 33487 LQHPWLK---------------------------------------------QRIDRVSTKVIRT 33506

Fly 355 QQQPVQQHQLAKS--GQIHS--KPTHNGHHRANSGGSISKIPIAT-------------------- 395
.:.....|.|.|. ..:.| :.:..|..|:..|.|::|:.:|:
Mouse 33507 LKHRRYYHTLIKKDLNMVVSAARISCGGAIRSQRGVSVAKVKVASIEIGPVSGQIMHAIGEEGGY 33571

Fly 396 ----SKLQSTPSSETTTAIHTLTSNSNG--------------HVHKPTQIVTPTRR---ASDSDK 439
.|:::...|...|....:....|. :|...|:....|.| .:|..:
Mouse 33572 VKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFDDGTYRCKVVNDYGE 33636

Fly 440 ENTYTATFVK----------------------------KPVATIQLGSSNGI--EDATVVATLTL 474
:::|...||| .|..|:.|.:.... |:.....|:|:
Mouse 33637 DSSYAELFVKGVREVYDYYCRRTKKVKRRTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITV 33701

Fly 475 FPDAPTTPKVI-----RKTPTGESNGSATSVKALVKKFQLEDSSGSAVARRSGGAVTSSSGLHSP 534
.|: |:|. :|...|:.. ||:..| |..||:..
Mouse 33702 HPE----PRVTWYKSGQKIKPGDDE----------KKYTFE----------------SDKGLYQL 33736

Fly 535 TTTSVRLNSIRRASEPLTTVYKKQTSQNGCSSTSNPSSSPGSSPTTSGSTATLLIHSQRLGNSTA 599
|..||..:. ....|.|.:.:..::.|.:....:..|..:.||... :..:.|.|:..
Mouse 33737 TINSVTTDD----DAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRP-----MFKRLLANAEC 33792

Fly 600 PASHCVAVPATATATSSASSSNSSSGKSTSAAHHLH--HHHMHHHHHHHH--------HHVVIAA 654
.....|......:...:.:......|:..|...|:. |..:.::..|.. ::.|.|.
Mouse 33793 HEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTAT 33857

Fly 655 KNAAAVAATNNLSLDQ 670
..|.:.:...:|.:::
Mouse 33858 NTAGSTSCQAHLQVER 33873

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Drak	NP_996411.2	STKc_DRAK	28..295	CDD:271008	88/264 (33%)
Drak	NP_996411.2	PHA03255	379..>554	CDD:165513	39/250 (16%)
Ttn	NP_001372637.1	IgI_1_Titin_Z1z2-like	6..98	CDD:409566
		Ig strand A	6..8	CDD:409566
		Ig strand A'	11..16	CDD:409566
		Ig strand B	23..31	CDD:409566
		Ig strand C	36..40	CDD:409566
		Ig strand C'	44..46	CDD:409566
		Ig strand D	53..59	CDD:409566
		Ig strand E	62..67	CDD:409566
		Ig strand F	76..84	CDD:409566
		Ig strand G	87..98	CDD:409566
		IgI_2_Titin_Z1z2-like	103..193	CDD:409564
		Ig strand A	103..106	CDD:409564
		Ig strand A'	109..113	CDD:409564
		Ig strand B	121..129	CDD:409564
		Ig strand C	134..139	CDD:409564
		Ig strand C'	142..144	CDD:409564
		Ig strand D	150..155	CDD:409564
		Ig strand E	158..163	CDD:409564
		Ig strand F	172..180	CDD:409564
		Ig strand G	183..193	CDD:409564
		PRK12323	<253..>346	CDD:481241
		PTZ00121	<413..725	CDD:173412
		I-set	946..1035	CDD:400151
		Ig strand B	963..967	CDD:409353
		Ig strand C	976..980	CDD:409353
		Ig strand E	1001..1005	CDD:409353
		Ig strand F	1015..1020	CDD:409353
		Ig strand G	1028..1031	CDD:409353
		I-set	1084..1173	CDD:400151
		Ig strand B	1101..1105	CDD:409405
		Ig strand C	1114..1118	CDD:409405
		Ig strand E	1141..1145	CDD:409405
		Ig strand F	1155..1160	CDD:409405
		Ig strand G	1168..1171	CDD:409405
		Ig	1295..1383	CDD:472250
		Ig strand B	1310..1314	CDD:409474
		Ig strand C	1323..1327	CDD:409474
		Ig strand E	1349..1353	CDD:409474
		Ig strand F	1363..1368	CDD:409474
		Ig strand G	1376..1379	CDD:409474
		Ig	1463..1553	CDD:472250
		Ig strand B	1480..1484	CDD:409405
		Ig strand C	1493..1497	CDD:409405
		Ig strand E	1519..1523	CDD:409405
		Ig strand F	1533..1538	CDD:409405
		Ig strand G	1546..1549	CDD:409405
		Ig	1562..1653	CDD:472250
		Ig strand B	1579..1583	CDD:409543
		Ig strand C	1592..1596	CDD:409543
		Ig strand E	1619..1623	CDD:409543
		Ig strand F	1633..1638	CDD:409543
		Ig strand G	1646..1649	CDD:409543
		Ig	<1728..1800	CDD:472250
		Ig strand C	1741..1745	CDD:409353
		Ig strand E	1766..1770	CDD:409353
		Ig strand F	1780..1785	CDD:409353
		Ig strand G	1793..1796	CDD:409353
		I-set	1847..1935	CDD:400151
		Ig strand B	1864..1868	CDD:409543
		Ig strand C	1877..1881	CDD:409543
		Ig strand E	1901..1905	CDD:409543
		Ig strand F	1915..1920	CDD:409543
		Ig strand G	1928..1931	CDD:409543
		IgI_titin_I1-like	2084..2175	CDD:409543
Ig strand A	2084..2086	CDD:409543
Ig strand A'	2088..2094	CDD:409543
Ig strand B	2101..2108	CDD:409543
Ig strand C	2114..2119	CDD:409543
Ig strand C'	2121..2124	CDD:409543
Ig strand D	2130..2134	CDD:409543
Ig strand E	2139..2146	CDD:409543
Ig strand F	2153..2161	CDD:409543
Ig strand G	2164..2175	CDD:409543
Ig	2182..2268	CDD:472250
Ig strand B	2198..2202	CDD:409559
Ig strand C	2210..2214	CDD:409559
Ig strand E	2235..2239	CDD:409559
Ig strand F	2249..2253	CDD:409559
Ig	2274..2358	CDD:472250
Ig strand B	2290..2294	CDD:409405
Ig strand C	2299..2306	CDD:409405
Ig strand E	2327..2331	CDD:409405
Ig	2363..2434	CDD:472250
Ig strand B	2379..2383	CDD:409405
Ig strand C	2391..2395	CDD:409405
Ig strand E	2416..2420	CDD:409405
Ig strand F	2430..2434	CDD:409405
Ig	2453..2536	CDD:472250
Ig strand B	2468..2472	CDD:409559
Ig strand C	2481..2485	CDD:409559
Ig strand E	2506..2510	CDD:409559
Ig strand F	2520..2525	CDD:409559
Ig strand G	2529..2532	CDD:409559
Ig	2540..2623	CDD:472250
Ig strand C	2568..2572	CDD:409559
Ig strand E	2593..2597	CDD:409559
Ig strand F	2607..2612	CDD:409559
Ig strand G	2616..2619	CDD:409559
Ig	2628..2710	CDD:472250
Ig strand C	2655..2659	CDD:409559
Ig strand E	2680..2684	CDD:409559
Ig strand F	2694..2699	CDD:409559
Ig strand G	2703..2706	CDD:409559
Ig	2714..2798	CDD:472250
Ig strand B	2730..2734	CDD:409543
Ig strand C	2743..2747	CDD:409543
Ig strand E	2768..2772	CDD:409543
Ig strand F	2782..2787	CDD:409543
Ig strand G	2791..2794	CDD:409543
Ig	2802..2885	CDD:472250
Ig strand B	2818..2822	CDD:409405
Ig strand C	2831..2834	CDD:409405
Ig strand E	2855..2859	CDD:409405
Ig strand F	2869..2874	CDD:409405
Ig strand G	2878..2881	CDD:409405
Ig	2889..2972	CDD:472250
Ig strand B	2905..2909	CDD:409543
Ig strand C	2918..2921	CDD:409543
Ig strand E	2942..2946	CDD:409543
Ig strand F	2956..2961	CDD:409543
Ig strand G	2965..2968	CDD:409543
Ig	2977..3059	CDD:472250
Ig strand B	2992..2996	CDD:409543
Ig strand C	3004..3008	CDD:409543
Ig strand E	3029..3033	CDD:409543
Ig strand F	3043..3048	CDD:409543
Ig strand G	3052..3055	CDD:409543
I-set	3065..3148	CDD:400151
Ig strand B	3081..3085	CDD:409543
Ig strand C	3093..3097	CDD:409543
Ig strand E	3118..3122	CDD:409543
Ig strand F	3132..3137	CDD:409543
Ig strand G	3141..3144	CDD:409543
Ig	3159..3239	CDD:472250
Ig strand B	3170..3174	CDD:409559
Ig strand C	3182..3186	CDD:409559
Ig strand E	3207..3213	CDD:409559
Ig strand F	3223..3228	CDD:409559
Ig strand G	3232..3235	CDD:409559
Ig	3245..3335	CDD:472250
Ig strand B	3262..3266	CDD:409543
Ig strand C	3275..3279	CDD:409543
Ig strand E	3300..3304	CDD:409543
Ig strand F	3314..3319	CDD:409543
Ig strand G	3327..3330	CDD:409543
I-set	3351..3437	CDD:400151
Ig strand B	3368..3372	CDD:409353
Ig strand C	3380..3384	CDD:409353
Ig strand E	3405..3409	CDD:409353
Ig strand F	3419..3424	CDD:409353
Ig strand G	3432..3435	CDD:409353
I-set	3471..3562	CDD:400151
Ig strand B	3488..3492	CDD:409543
Ig strand C	3501..3505	CDD:409543
Ig strand E	3528..3532	CDD:409543
Ig strand F	3542..3547	CDD:409543
Ig strand G	3555..3558	CDD:409543
I-set	3634..3721	CDD:400151
Ig strand B	3651..3655	CDD:409405
Ig strand C	3664..3668	CDD:409405
Ig strand E	3689..3693	CDD:409405
Ig strand F	3703..3708	CDD:409405
Ig strand G	3716..3719	CDD:409405
I-set	3750..3840	CDD:400151
Ig strand B	3767..3771	CDD:409353
Ig strand C	3780..3784	CDD:409353
Ig strand E	3806..3810	CDD:409353
Ig strand F	3820..3825	CDD:409353
Ig strand G	3833..3836	CDD:409353
Ig	4376..4463	CDD:472250
Ig strand B	4393..4397	CDD:409405
Ig strand C	4404..4408	CDD:409405
Ig strand E	4429..4433	CDD:409405
Ig strand F	4443..4448	CDD:409405
Ig strand G	4456..4459	CDD:409405
I-set	4469..4558	CDD:400151
Ig strand B	4486..4490	CDD:409543
Ig strand C	4499..4503	CDD:409543
Ig strand E	4524..4528	CDD:409543
Ig strand F	4538..4543	CDD:409543
Ig strand G	4551..4554	CDD:409543
I-set	4564..4653	CDD:400151
Ig strand B	4581..4585	CDD:409405
Ig strand C	4594..4598	CDD:409405
Ig strand E	4619..4623	CDD:409405
Ig strand F	4633..4638	CDD:409405
Ig strand G	4646..4649	CDD:409405
Ig	4657..4730	CDD:472250
Ig strand B	4674..4678	CDD:409353
Ig strand C	4687..4691	CDD:409353
Ig strand E	4712..4716	CDD:409353
Ig strand F	4726..4730	CDD:409353
I-set	4750..4840	CDD:400151
Ig strand B	4768..4772	CDD:409353
Ig strand C	4781..4785	CDD:409353
Ig strand E	4806..4810	CDD:409353
Ig strand F	4820..4825	CDD:409353
I-set	4844..4930	CDD:400151
Ig strand B	4861..4865	CDD:409353
Ig strand C	4874..4878	CDD:409353
Ig strand E	4899..4903	CDD:409353
Ig strand F	4913..4918	CDD:409353
I-set	4937..5026	CDD:400151
Ig strand B	4954..4958	CDD:409353
Ig strand C	4967..4971	CDD:409353
Ig strand E	4992..4996	CDD:409353
Ig strand F	5006..5011	CDD:409353
Ig strand G	5019..5022	CDD:409353
I-set	5039..5119	CDD:400151
Ig strand B	5047..5051	CDD:409353
Ig strand C	5060..5064	CDD:409353
Ig strand E	5085..5089	CDD:409353
Ig strand F	5099..5104	CDD:409353
Ig strand G	5113..5116	CDD:409353
I-set	5126..5215	CDD:400151
Ig strand B	5144..5147	CDD:409353
Ig strand C	5156..5160	CDD:409353
Ig strand E	5181..5185	CDD:409353
Ig strand F	5195..5200	CDD:409353
Ig strand G	5209..5212	CDD:409353
I-set	5219..5308	CDD:400151
Ig strand B	5236..5240	CDD:409353
Ig strand C	5249..5253	CDD:409353
Ig strand E	5274..5278	CDD:409353
Ig strand F	5288..5293	CDD:409353
Ig strand G	5301..5304	CDD:409353
I-set	5314..5402	CDD:400151
Ig strand B	5330..5334	CDD:409405
Ig strand C	5343..5347	CDD:409405
Ig strand E	5369..5372	CDD:409405
Ig strand F	5382..5387	CDD:409405
I-set	5406..5494	CDD:400151
Ig strand B	5423..5427	CDD:409353
Ig strand C	5436..5440	CDD:409353
Ig strand E	5461..5465	CDD:409353
Ig strand F	5475..5480	CDD:409353
Ig	5499..5588	CDD:472250
Ig strand C	5529..5533	CDD:409353
Ig strand E	5554..5558	CDD:409353
Ig strand F	5568..5573	CDD:409353
Ig	5600..5681	CDD:472250
Ig strand B	5609..5613	CDD:409406
Ig strand C	5622..5626	CDD:409406
Ig strand E	5647..5651	CDD:409406
Ig strand F	5661..5666	CDD:409406
Ig strand G	5676..5679	CDD:409406
I-set	5688..5777	CDD:400151
Ig strand C	5718..5722	CDD:409353
Ig strand E	5743..5747	CDD:409353
Ig strand F	5757..5762	CDD:409353
Ig	5781..5870	CDD:472250
Ig strand B	5798..5802	CDD:409353
Ig strand C	5811..5815	CDD:409353
Ig strand E	5836..5840	CDD:409353
Ig strand F	5850..5855	CDD:409353
Ig strand G	5863..5866	CDD:409353
I-set	5874..5964	CDD:400151
Ig strand B	5893..5896	CDD:409353
Ig strand C	5905..5909	CDD:409353
Ig strand E	5930..5934	CDD:409353
Ig strand F	5944..5949	CDD:409353
Ig strand G	5957..5960	CDD:409353
I-set	5968..6056	CDD:400151
Ig strand B	5985..5989	CDD:409543
Ig strand C	5998..6002	CDD:409543
Ig strand E	6023..6027	CDD:409543
Ig strand F	6037..6042	CDD:409543
Ig strand G	6050..6053	CDD:409543
I-set	6061..6150	CDD:400151
Ig strand B	6078..6082	CDD:409353
Ig strand C	6091..6095	CDD:409353
Ig strand E	6116..6120	CDD:409353
Ig strand F	6130..6135	CDD:409353
I-set	6155..6243	CDD:400151
Ig strand B	6171..6175	CDD:409353
Ig strand C	6184..6188	CDD:409353
Ig strand E	6209..6213	CDD:409353
Ig strand F	6223..6228	CDD:409353
I-set	6250..6339	CDD:400151
Ig strand B	6267..6271	CDD:409353
Ig strand C	6280..6284	CDD:409353
Ig strand E	6305..6309	CDD:409353
Ig strand F	6319..6324	CDD:409353
Ig strand G	6332..6335	CDD:409353
I-set	6343..6432	CDD:400151
Ig strand B	6360..6364	CDD:409353
Ig strand C	6373..6377	CDD:409353
Ig strand E	6398..6402	CDD:409353
Ig strand F	6412..6417	CDD:409353
Ig strand G	6425..6428	CDD:409353
I-set	6436..6526	CDD:400151
Ig strand B	6454..6458	CDD:409405
Ig strand C	6467..6471	CDD:409405
Ig strand E	6492..6496	CDD:409405
Ig strand F	6506..6511	CDD:409405
Ig strand G	6519..6522	CDD:409405
I-set	6530..6618	CDD:400151
Ig strand B	6547..6551	CDD:409353
Ig strand C	6560..6564	CDD:409353
Ig strand E	6585..6589	CDD:409353
Ig strand F	6599..6604	CDD:409353
I-set	6623..6713	CDD:400151
Ig strand B	6640..6644	CDD:409419
Ig strand C	6653..6657	CDD:409419
Ig strand E	6679..6683	CDD:409419
Ig strand F	6693..6698	CDD:409419
Ig strand G	6706..6709	CDD:409419
I-set	6718..6806	CDD:400151
Ig strand C	6747..6751	CDD:409353
Ig strand E	6772..6776	CDD:409353
Ig strand F	6786..6791	CDD:409353
Ig strand G	6800..6803	CDD:409353
I-set	6813..6902	CDD:400151
Ig strand C	6843..6847	CDD:409353
Ig strand E	6868..6872	CDD:409353
Ig strand F	6882..6887	CDD:409353
I-set	6906..6995	CDD:400151
Ig strand B	6923..6927	CDD:409353
Ig strand C	6936..6940	CDD:409353
Ig strand E	6961..6965	CDD:409353
Ig strand F	6975..6980	CDD:409353
Ig strand G	6988..6991	CDD:409353
I-set	7001..7086	CDD:400151
Ig strand B	7016..7020	CDD:409353
Ig strand C	7029..7033	CDD:409353
Ig strand E	7054..7058	CDD:409353
Ig strand F	7068..7073	CDD:409353
I-set	7092..7173	CDD:400151
Ig strand B	7109..7113	CDD:409353
Ig strand C	7122..7126	CDD:409353
Ig strand E	7147..7151	CDD:409353
Ig strand F	7161..7166	CDD:409353
Ig strand G	7175..7178	CDD:409353
I-set	7188..7276	CDD:400151
Ig strand B	7205..7209	CDD:409353
Ig strand C	7218..7222	CDD:409353
Ig strand E	7243..7247	CDD:409353
Ig strand F	7257..7262	CDD:409353
I-set	7284..7373	CDD:400151
Ig strand B	7301..7305	CDD:409405
Ig strand C	7314..7318	CDD:409405
Ig strand E	7340..7343	CDD:409405
Ig strand F	7353..7358	CDD:409405
Ig strand G	7366..7369	CDD:409405
I-set	7377..7467	CDD:400151
Ig strand B	7395..7399	CDD:409353
Ig strand C	7408..7412	CDD:409353
Ig strand E	7433..7437	CDD:409353
Ig strand F	7447..7452	CDD:409353
Ig strand G	7460..7463	CDD:409353
I-set	7471..7559	CDD:400151
Ig strand B	7488..7492	CDD:409353
Ig strand C	7501..7505	CDD:409353
Ig strand E	7526..7530	CDD:409353
Ig strand F	7540..7545	CDD:409353
I-set	7564..7654	CDD:400151
Ig strand B	7581..7585	CDD:409419
Ig strand C	7594..7598	CDD:409419
Ig strand E	7620..7624	CDD:409419
Ig strand F	7634..7639	CDD:409419
Ig strand G	7647..7650	CDD:409419
I-set	7660..7747	CDD:400151
Ig strand B	7675..7679	CDD:409353
Ig strand C	7688..7692	CDD:409353
Ig strand E	7713..7717	CDD:409353
Ig strand F	7727..7732	CDD:409353
I-set	7754..7843	CDD:400151
Ig strand B	7771..7775	CDD:409353
Ig strand C	7784..7788	CDD:409353
Ig strand E	7809..7813	CDD:409353
Ig strand F	7823..7828	CDD:409353
Ig strand G	7836..7839	CDD:409353
I-set	7847..7936	CDD:400151
Ig strand B	7864..7868	CDD:409353
Ig strand C	7877..7881	CDD:409353
Ig strand E	7902..7906	CDD:409353
Ig strand F	7916..7921	CDD:409353
Ig strand G	7929..7932	CDD:409353
Ig	7942..8029	CDD:472250
Ig strand B	7957..7961	CDD:409543
Ig strand C	7970..7974	CDD:409543
Ig strand E	7995..7999	CDD:409543
Ig strand F	8009..8014	CDD:409543
Ig strand G	8022..8025	CDD:409543
I-set	8033..8122	CDD:400151
Ig strand B	8050..8054	CDD:409353
Ig strand C	8063..8067	CDD:409353
Ig strand E	8088..8092	CDD:409353
Ig strand F	8102..8107	CDD:409353
Ig strand G	8116..8119	CDD:409353
I-set	8129..8217	CDD:400151
Ig strand B	8146..8150	CDD:409353
Ig strand C	8159..8163	CDD:409353
Ig strand E	8184..8188	CDD:409353
Ig strand F	8198..8203	CDD:409353
I-set	8225..8314	CDD:400151
Ig strand B	8242..8246	CDD:409405
Ig strand C	8255..8259	CDD:409405
Ig strand E	8280..8284	CDD:409405
Ig strand F	8294..8299	CDD:409405
Ig strand G	8307..8310	CDD:409405
Ig	8318..8395	CDD:472250
Ig strand C	8349..8353	CDD:409353
Ig strand E	8374..8378	CDD:409353
Ig strand F	8388..8393	CDD:409353
I-set	8412..8500	CDD:400151
Ig strand B	8429..8433	CDD:409353
Ig strand C	8442..8446	CDD:409353
Ig strand E	8467..8471	CDD:409353
Ig strand F	8481..8486	CDD:409353
I-set	8505..8595	CDD:400151
Ig strand B	8522..8526	CDD:409353
Ig strand C	8535..8539	CDD:409353
Ig strand E	8561..8565	CDD:409353
Ig strand F	8575..8580	CDD:409353
Ig strand G	8588..8591	CDD:409353
I-set	8601..8688	CDD:400151
Ig strand B	8617..8620	CDD:409353
Ig strand C	8629..8633	CDD:409353
Ig strand E	8654..8658	CDD:409353
Ig strand F	8668..8673	CDD:409353
I-set	8695..8784	CDD:400151
Ig strand B	8712..8716	CDD:409353
Ig strand C	8725..8729	CDD:409353
Ig strand E	8750..8754	CDD:409353
Ig strand F	8764..8769	CDD:409353
Ig strand G	8777..8780	CDD:409353
I-set	8788..8877	CDD:400151
Ig strand B	8805..8809	CDD:409353
Ig strand C	8818..8822	CDD:409353
Ig strand E	8843..8847	CDD:409353
Ig strand F	8857..8862	CDD:409353
I-set	8883..8967	CDD:400151
Ig strand B	8898..8902	CDD:409406
Ig strand C	8911..8915	CDD:409406
Ig strand E	8936..8940	CDD:409406
Ig strand F	8950..8955	CDD:409406
I-set	8974..9063	CDD:400151
Ig strand B	8991..8995	CDD:409353
Ig strand C	9004..9008	CDD:409353
Ig strand E	9029..9033	CDD:409353
Ig strand F	9043..9048	CDD:409353
Ig strand G	9057..9060	CDD:409353
I-set	9070..9158	CDD:400151
Ig strand B	9087..9091	CDD:409353
Ig strand C	9100..9104	CDD:409353
Ig strand E	9125..9129	CDD:409353
Ig strand F	9139..9144	CDD:409353
Ig strand G	9152..9155	CDD:409353
I-set	9166..9255	CDD:400151
Ig strand B	9183..9187	CDD:409353
Ig strand C	9196..9200	CDD:409353
Ig strand E	9221..9225	CDD:409353
Ig strand F	9235..9240	CDD:409353
Ig strand G	9248..9251	CDD:409353
Ig	9262..9352	CDD:472250
Ig strand B	9280..9284	CDD:409543
Ig strand C	9293..9297	CDD:409543
Ig strand E	9318..9322	CDD:409543
Ig strand F	9332..9337	CDD:409543
Ig strand G	9345..9348	CDD:409543
I-set	9359..9448	CDD:400151
Ig strand B	9376..9380	CDD:409353
Ig strand C	9389..9393	CDD:409353
Ig strand E	9414..9418	CDD:409353
Ig strand F	9428..9433	CDD:409353
Ig strand G	9441..9444	CDD:409353
I-set	9469..9557	CDD:400151
Ig strand B	9484..9488	CDD:409543
Ig strand C	9497..9501	CDD:409543
Ig strand E	9523..9527	CDD:409543
Ig strand F	9537..9542	CDD:409543
Ig strand G	9550..9553	CDD:409543
THB	9591..9621	CDD:465725
Ig	9675..9755	CDD:472250
Ig strand C	9700..9704	CDD:409353
Ig strand E	9725..9729	CDD:409353
Ig	9758..9840	CDD:472250
Ig strand B	9775..9779	CDD:409405
Ig strand C	9787..9791	CDD:409405
Ig strand E	9812..9816	CDD:409405
Ig strand G	9835..9838	CDD:409405
I-set	9848..9934	CDD:400151
Ig strand B	9864..9868	CDD:409543
Ig strand C	9876..9880	CDD:409543
Ig strand E	9901..9905	CDD:409543
Ig strand F	9915..9920	CDD:409543
Ig strand G	9929..9932	CDD:409543
PTZ00121	<10208..10736	CDD:173412
PTZ00449	<11550..11841	CDD:185628
PHA03247	<11702..12305	CDD:223021
PRK10263	<12181..>12511	CDD:236669
Ig	13103..13194	CDD:472250
Ig strand B	13123..13127	CDD:409353
Ig strand C	13136..13139	CDD:409353
Ig strand E	13160..13164	CDD:409353
Ig strand F	13174..13179	CDD:409353
IG_like	13207..13277	CDD:214653
IG_like	13300..>13364	CDD:214653
Ig	13475..13557	CDD:472250
Ig strand B	13490..13494	CDD:409353
Ig strand C	13502..13505	CDD:409353
Ig strand E	13527..13530	CDD:409353
Ig	13562..13645	CDD:472250
Ig strand B	13578..13582	CDD:409543
Ig strand C	13590..13594	CDD:409543
Ig strand E	13615..13619	CDD:409543
Ig strand F	13629..13634	CDD:409543
Ig strand G	13638..13641	CDD:409543
Ig	13650..13733	CDD:472250
Ig strand B	13667..13671	CDD:409559
Ig strand C	13678..13682	CDD:409559
Ig strand E	13703..13707	CDD:409559
Ig strand F	13717..13722	CDD:409559
Ig strand G	13726..13729	CDD:409559
Ig	13739..13822	CDD:472250
Ig strand B	13755..13759	CDD:409543
Ig strand C	13767..13771	CDD:409543
Ig strand E	13792..13796	CDD:409543
Ig strand F	13806..13811	CDD:409543
Ig strand G	13815..13818	CDD:409543
Ig	13829..13903	CDD:472250
Ig strand B	13844..13848	CDD:409543
Ig strand C	13856..13860	CDD:409543
Ig strand E	13881..13885	CDD:409543
Ig strand F	13895..13900	CDD:409543
Ig	13917..14000	CDD:472250
Ig	14005..14089	CDD:472250
Ig strand B	14022..14026	CDD:409353
Ig strand C	14035..14038	CDD:409353
Ig strand E	14059..14063	CDD:409353
Ig strand G	14082..14085	CDD:409353
Ig	14095..14178	CDD:472250
Ig	14186..14257	CDD:472250
Ig strand B	14200..14204	CDD:409559
Ig strand C	14212..14216	CDD:409559
Ig strand E	14237..14241	CDD:409559
Ig strand F	14251..14256	CDD:409559
Ig strand G	14260..14263	CDD:409559
Ig	14273..14356	CDD:472250
Ig strand B	14289..14293	CDD:409543
Ig strand C	14301..14305	CDD:409543
Ig strand E	14326..14330	CDD:409543
Ig strand F	14340..14345	CDD:409543
Ig strand G	14349..14352	CDD:409543
Ig	14362..14433	CDD:472250
Ig strand B	14378..14382	CDD:409543
Ig strand C	14390..14394	CDD:409543
Ig strand E	14415..14419	CDD:409543
Ig strand F	14429..14433	CDD:409543
IG_like	14458..14522	CDD:214653
Ig strand B	14467..14471	CDD:409559
Ig strand C	14479..14483	CDD:409559
Ig strand E	14504..14508	CDD:409559
Ig strand F	14518..14523	CDD:409559
Ig strand G	14527..14530	CDD:409559
Ig	14540..14623	CDD:472250
Ig strand B	14556..14560	CDD:409390
Ig strand C	14568..14572	CDD:409390
Ig strand E	14593..14597	CDD:409390
Ig strand G	14616..14619	CDD:409390
Ig	14629..14717	CDD:472250
Ig strand B	14644..14648	CDD:409543
Ig strand C	14656..14660	CDD:409543
Ig strand E	14681..14685	CDD:409543
Ig strand F	14695..14700	CDD:409543
Ig strand G	14709..14712	CDD:409543
Ig	14722..14805	CDD:472250
Ig strand B	14738..14742	CDD:409405
Ig strand C	14750..14754	CDD:409405
Ig strand E	14775..14779	CDD:409405
Ig strand F	14789..14794	CDD:409405
Ig strand G	14798..14801	CDD:409405
Ig	14811..14894	CDD:472250
Ig strand B	14827..14831	CDD:409543
Ig strand C	14839..14843	CDD:409543
Ig strand E	14864..14868	CDD:409543
Ig strand F	14878..14883	CDD:409543
Ig strand G	14887..14890	CDD:409543
Ig	14900..14982	CDD:472250
Ig	14996..15073	CDD:472250
Ig strand B	15004..15008	CDD:409406
Ig strand C	15017..15021	CDD:409406
Ig strand E	15039..15043	CDD:409406
Ig strand F	15053..15058	CDD:409406
Ig strand G	15066..15069	CDD:409406
FN3	<15092..>15437	CDD:442628
FN3	<15469..15848	CDD:442628
FN3	15752..16205	CDD:442628
FN3	<16075..>16361	CDD:442628
Ig	16383..16463	CDD:472250
Ig strand B	16391..16395	CDD:409406
Ig strand C	16404..16408	CDD:409406
Ig strand E	16429..16433	CDD:409406
Ig strand F	16443..16448	CDD:409406
Ig strand G	16456..16459	CDD:409406
FN3	16467..16553	CDD:238020
FN3	16572..16659	CDD:238020
Ig	16678..16785	CDD:472250
Ig strand B	16684..16688	CDD:409406
Ig strand C	16697..16701	CDD:409406
Ig strand E	16751..16755	CDD:409406
Ig strand F	16765..16770	CDD:409406
Ig strand G	16778..16781	CDD:409406
FN3	16789..16880	CDD:238020
FN3	16890..16982	CDD:238020
FN3	16996..17082	CDD:238020
FN3	<17115..17477	CDD:442628
FN3	17282..17374	CDD:238020
FN3	17453..>17789	CDD:442628
Ig_Titin_like	17806..17895	CDD:409406
Ig strand A	17806..17810	CDD:409406
Ig strand B	17815..17821	CDD:409406
Ig strand C	17827..17833	CDD:409406
Ig strand D	17853..17858	CDD:409406
Ig strand E	17859..17865	CDD:409406
Ig strand F	17874..17882	CDD:409406
Ig strand G	17885..17895	CDD:409406
FN3	17899..17991	CDD:238020
FN3	18004..18093	CDD:238020
Ig	18115..18200	CDD:472250
Ig strand B	18121..18125	CDD:409406
Ig strand C	18134..18143	CDD:409406
Ig strand E	18166..18170	CDD:409406
Ig strand F	18180..18185	CDD:409406
Ig strand G	18193..18196	CDD:409406
FN3	18204..18296	CDD:238020
FN3	18304..18401	CDD:238020
FN3	18415..18500	CDD:238020
Ig_Titin_like	18520..18599	CDD:409406
Ig strand A	18520..18524	CDD:409406
Ig strand B	18529..18535	CDD:409406
Ig strand C	18541..18547	CDD:409406
Ig strand D	18557..18562	CDD:409406
Ig strand E	18563..18569	CDD:409406
Ig strand F	18578..18586	CDD:409406
FN3	<18580..18983	CDD:442628
Ig strand G	18589..18599	CDD:409406
FN3	18704..18797	CDD:238020
FN3	<18919..>19190	CDD:442628
Ig	19216..19293	CDD:472250
Ig strand B	19223..19227	CDD:409406
Ig strand C	19236..19240	CDD:409406
Ig strand E	19259..19263	CDD:409406
Ig strand F	19273..19278	CDD:409406
Ig strand G	19286..19289	CDD:409406
FN3	19297..19384	CDD:238020
FN3	19397..19486	CDD:238020
FN3	19492..19982	CDD:442628
FN3	19989..20079	CDD:238020
FN3	20088..20181	CDD:238020
Ig	20188..20281	CDD:472250
Ig strand B	20206..20210	CDD:409353
Ig strand C	20219..20223	CDD:409353
Ig strand E	20246..20250	CDD:409353
Ig strand F	20260..20265	CDD:409353
Ig strand G	20273..20276	CDD:409353
FN3	20284..20375	CDD:238020
FN3	20383..20476	CDD:238020
FN3	20484..20582	CDD:238020
Ig_Titin_like	20603..20682	CDD:409406
Ig strand A	20603..20606	CDD:409406
Ig strand B	20611..20617	CDD:409406
Ig strand C	20623..20629	CDD:409406
Ig strand D	20640..20645	CDD:409406
Ig strand E	20646..20652	CDD:409406
Ig strand F	20661..20669	CDD:409406
Ig strand G	20672..20682	CDD:409406
FN3	20686..20772	CDD:238020
FN3	20786..20869	CDD:238020
Ig	20895..20975	CDD:472250
Ig strand B	20903..20907	CDD:409406
Ig strand C	20916..20920	CDD:409406
FN3	20926..>21321	CDD:442628
Ig strand E	20941..20945	CDD:409406
Ig strand F	20955..20960	CDD:409406
Ig strand G	20968..20971	CDD:409406
FN3	21079..21172	CDD:238020
Ig	21292..21372	CDD:472250
Ig strand B	21300..21304	CDD:409406
Ig strand C	21313..21317	CDD:409406
Ig strand E	21338..21342	CDD:409406
Ig strand F	21352..21357	CDD:409406
Ig strand G	21365..21368	CDD:409406
FN3	21376..21467	CDD:238020
FN3	21475..21567	CDD:238020
FN3	21576..21664	CDD:238020
Ig_Titin_like	21689..21770	CDD:409406
Ig strand A	21689..21693	CDD:409406
Ig strand B	21698..21704	CDD:409406
Ig strand C	21710..21716	CDD:409406
Ig strand D	21728..21733	CDD:409406
Ig strand E	21734..21740	CDD:409406
Ig strand F	21749..21757	CDD:409406
Ig strand G	21760..21770	CDD:409406
FN3	21774..21865	CDD:238020
FN3	21871..21955	CDD:238020
Ig_Titin_like	21978..22059	CDD:409406
Ig strand A	21978..21982	CDD:409406
Ig strand B	21987..21993	CDD:409406
Ig strand C	21999..22005	CDD:409406
FN3	22007..22514	CDD:442628
Ig strand D	22017..22022	CDD:409406
Ig strand E	22023..22029	CDD:409406
Ig strand F	22038..22046	CDD:409406
Ig strand G	22049..22059	CDD:409406
FN3	22357..22872	CDD:442628
Ig_Titin_like	22772..22851	CDD:409406
Ig strand A	22772..22776	CDD:409406
Ig strand B	22781..22787	CDD:409406
Ig strand C	22793..22799	CDD:409406
Ig strand D	22809..22814	CDD:409406
Ig strand E	22815..22821	CDD:409406
Ig strand F	22830..22838	CDD:409406
Ig strand G	22841..22851	CDD:409406
FN3	22855..22944	CDD:238020
FN3	22952..23043	CDD:238020
Ig_Titin_like	23062..23142	CDD:409406
Ig strand A	23062..23065	CDD:409406
Ig strand B	23070..23076	CDD:409406
Ig strand C	23082..23088	CDD:409406
Ig strand D	23100..23105	CDD:409406
Ig strand E	23106..23112	CDD:409406
FN3	23116..>23438	CDD:442628
Ig strand F	23121..23129	CDD:409406
Ig strand G	23132..23142	CDD:409406
Ig	23457..23538	CDD:472250
Ig strand B	23466..23470	CDD:409406
Ig strand C	23479..23483	CDD:409406
Ig strand E	23504..23508	CDD:409406
Ig strand F	23518..23523	CDD:409406
Ig strand G	23531..23534	CDD:409406
FN3	<23584..>23830	CDD:442628
Ig_Titin_like	23856..23935	CDD:409406
Ig strand A	23856..23860	CDD:409406
Ig strand B	23865..23871	CDD:409406
FN3	<23875..24263	CDD:442628
Ig strand C	23877..23883	CDD:409406
Ig strand D	23893..23898	CDD:409406
Ig strand E	23899..23905	CDD:409406
Ig strand F	23914..23922	CDD:409406
Ig strand G	23925..23935	CDD:409406
Ig_Titin_like	24143..24224	CDD:409406
Ig strand A	24143..24147	CDD:409406
Ig strand B	24152..24158	CDD:409406
Ig strand C	24164..24170	CDD:409406
Ig strand D	24182..24187	CDD:409406
Ig strand E	24188..24194	CDD:409406
Ig strand F	24203..24211	CDD:409406
Ig strand G	24214..24224	CDD:409406
FN3	24228..24320	CDD:238020
FN3	24328..24420	CDD:238020
FN3	24427..24520	CDD:238020
Ig_Titin_like	24539..24620	CDD:409406
Ig strand A	24539..24543	CDD:409406
Ig strand B	24548..24554	CDD:409406
Ig strand C	24560..24566	CDD:409406
Ig strand D	24578..24583	CDD:409406
Ig strand E	24584..24590	CDD:409406
Ig strand F	24599..24607	CDD:409406
Ig strand G	24610..24620	CDD:409406
FN3	24624..24716	CDD:238020
FN3	24724..24813	CDD:238020
FN3	24825..24913	CDD:238020
Ig_Titin_like	24938..25017	CDD:409406
Ig strand A	24938..24942	CDD:409406
Ig strand B	24947..24953	CDD:409406
Ig strand C	24959..24965	CDD:409406
FN3	<24966..25396	CDD:442628
Ig strand D	24975..24980	CDD:409406
Ig strand E	24981..24987	CDD:409406
Ig strand F	24996..25004	CDD:409406
Ig strand G	25007..25017	CDD:409406
FN3	25266..>25596	CDD:442628
Ig	25621..25702	CDD:472250
Ig strand B	25630..25634	CDD:409406
Ig strand C	25643..25647	CDD:409406
Ig strand E	25668..25672	CDD:409406
FN3	<25682..25965	CDD:442628
Ig strand F	25682..25687	CDD:409406
Ig strand G	25695..25698	CDD:409406
FN3	25806..25896	CDD:238020
Ig_Titin_like	26021..26099	CDD:409406
Ig strand A	26021..26024	CDD:409406
Ig strand B	26029..26035	CDD:409406
Ig strand C	26041..26047	CDD:409406
Ig strand D	26057..26062	CDD:409406
FN3	<26061..26447	CDD:442628
Ig strand E	26063..26069	CDD:409406
Ig strand F	26078..26086	CDD:409406
Ig strand G	26089..26099	CDD:409406
Ig_Titin_like	26307..26388	CDD:409406
Ig strand A	26307..26311	CDD:409406
Ig strand B	26316..26322	CDD:409406
Ig strand C	26328..26334	CDD:409406
Ig strand D	26346..26351	CDD:409406
Ig strand E	26352..26358	CDD:409406
Ig strand F	26367..26375	CDD:409406
FN3	26376..>26685	CDD:442628
Ig strand G	26378..26388	CDD:409406
Ig	26703..26785	CDD:472250
Ig strand B	26712..26716	CDD:409406
Ig strand C	26725..26729	CDD:409406
Ig strand E	26751..26755	CDD:409406
Ig strand F	26765..26770	CDD:409406
Ig strand G	26778..26781	CDD:409406
FN3	<26831..27243	CDD:442628
FN3	27283..27366	CDD:238020
FN3	27343..27862	CDD:442628
Ig_Titin_like	27390..27471	CDD:409406
Ig strand A	27390..27394	CDD:409406
Ig strand B	27399..27405	CDD:409406
Ig strand C	27411..27417	CDD:409406
Ig strand D	27429..27434	CDD:409406
Ig strand E	27435..27441	CDD:409406
Ig strand F	27450..27458	CDD:409406
Ig strand G	27461..27471	CDD:409406
Ig_Titin_like	27785..27866	CDD:409406
Ig strand A	27785..27789	CDD:409406
Ig strand B	27794..27800	CDD:409406
Ig strand C	27806..27812	CDD:409406
Ig strand D	27824..27829	CDD:409406
Ig strand E	27830..27836	CDD:409406
Ig strand F	27845..27853	CDD:409406
Ig strand G	27856..27866	CDD:409406
FN3	<27912..28297	CDD:442628
Ig_Titin_like	28182..28261	CDD:409406
Ig strand A	28182..28186	CDD:409406
Ig strand B	28191..28197	CDD:409406
Ig strand C	28203..28209	CDD:409406
Ig strand D	28219..28224	CDD:409406
Ig strand E	28225..28231	CDD:409406
Ig strand F	28240..28248	CDD:409406
Ig strand G	28251..28261	CDD:409406
FN3	28265..28356	CDD:238020
FN3	28362..28445	CDD:238020
Ig_Titin_like	28472..28553	CDD:409406
Ig strand A	28472..28476	CDD:409406
Ig strand B	28481..28487	CDD:409406
Ig strand C	28493..28499	CDD:409406
Ig strand D	28511..28516	CDD:409406
Ig strand E	28517..28523	CDD:409406
FN3	28519..29233	CDD:442628
Ig strand F	28532..28540	CDD:409406
Ig strand G	28543..28553	CDD:409406
Ig_Titin_like	28868..28949	CDD:409406
Ig strand A	28868..28872	CDD:409406
Ig strand B	28877..28883	CDD:409406
Ig strand C	28889..28895	CDD:409406
Ig strand D	28907..28912	CDD:409406
Ig strand E	28913..28919	CDD:409406
Ig strand F	28928..28936	CDD:409406
Ig strand G	28939..28949	CDD:409406
Ig_Titin_like	29268..29349	CDD:409406
Ig strand A	29268..29271	CDD:409406
Ig strand B	29276..29282	CDD:409406
FN3	<29286..>29550	CDD:442628
Ig strand C	29288..29294	CDD:409406
Ig strand D	29306..29311	CDD:409406
Ig strand E	29312..29318	CDD:409406
Ig strand F	29327..29335	CDD:409406
Ig strand G	29338..29349	CDD:409406
Ig	29560..29627	CDD:472250
Ig strand B	29568..29572	CDD:409406
Ig strand C	29581..29585	CDD:409406
Ig strand E	29606..29610	CDD:409406
Ig strand F	29620..29625	CDD:409406
FN3	29644..29736	CDD:238020
FN3	<29707..>29929	CDD:442628
Ig	29955..30035	CDD:472250
Ig strand B	29963..29967	CDD:409406
Ig strand C	29976..29980	CDD:409406
Ig strand E	30001..30005	CDD:409406
FN3	30013..30471	CDD:442628
Ig strand F	30015..30020	CDD:409406
Ig strand G	30028..30031	CDD:409406
Ig_Titin_like	30353..30432	CDD:409406
Ig strand A	30353..30357	CDD:409406
Ig strand B	30362..30368	CDD:409406
Ig strand C	30374..30380	CDD:409406
Ig strand D	30390..30395	CDD:409406
Ig strand E	30396..30402	CDD:409406
Ig strand F	30411..30419	CDD:409406
Ig strand G	30422..30432	CDD:409406
FN3	30436..30520	CDD:238020
FN3	30533..30616	CDD:238020
Ig_Titin_like	30644..30724	CDD:409406
Ig strand A	30644..30647	CDD:409406
Ig strand B	30652..30658	CDD:409406
Ig strand C	30664..30670	CDD:409406
FN3	30678..31124	CDD:442628
Ig strand D	30682..30687	CDD:409406
Ig strand E	30688..30694	CDD:409406
Ig strand F	30703..30711	CDD:409406
Ig strand G	30714..30724	CDD:409406
FN3	31128..31219	CDD:238020
FN3	<31183..31560	CDD:442628
Ig_Titin_like	31442..31521	CDD:409406
Ig strand A	31442..31446	CDD:409406
Ig strand B	31451..31457	CDD:409406
Ig strand C	31463..31469	CDD:409406
Ig strand D	31479..31484	CDD:409406
Ig strand E	31485..31491	CDD:409406
Ig strand F	31500..31508	CDD:409406
Ig strand G	31511..31521	CDD:409406
FN3	31525..31616	CDD:238020
FN3	31622..31715	CDD:238020
FN3	31756..>32115	CDD:442628
Ig_Titin_like	32133..32211	CDD:409406
Ig strand A	32133..32136	CDD:409406
Ig strand B	32141..32147	CDD:409406
Ig strand C	32153..32159	CDD:409406
Ig strand D	32169..32174	CDD:409406
Ig strand E	32175..32181	CDD:409406
Ig strand F	32190..32198	CDD:409406
Ig strand G	32201..32211	CDD:409406
FN3	32218..32298	CDD:214495
FN3	<32260..32620	CDD:442628
Ig	32629..32704	CDD:472250
Ig strand B	32633..32637	CDD:409406
Ig strand C	32646..32650	CDD:409406
Ig strand E	32671..32675	CDD:409406
Ig strand F	32686..32691	CDD:409406
Ig strand G	32699..32702	CDD:409406
FN3	32710..32803	CDD:238020
FN3	32812..32905	CDD:238020
Ig	32915..33007	CDD:472250
Ig strand B	32932..32936	CDD:409543
Ig strand C	32945..32949	CDD:409543
Ig strand E	32972..32976	CDD:409543
Ig strand F	32986..32991	CDD:409543
Ig strand G	32999..33002	CDD:409543
Ig_Titin_like	33024..33105	CDD:409406
Ig strand A	33024..33027	CDD:409406
Ig strand B	33032..33038	CDD:409406
Ig strand C	33044..33050	CDD:409406
Ig strand D	33062..33067	CDD:409406
Ig strand E	33068..33074	CDD:409406
Ig strand F	33084..33092	CDD:409406
Ig strand G	33095..33105	CDD:409406
FN3	33109..33200	CDD:238020
STKc_Titin	33237..33513	CDD:271006	90/326 (28%)
IgI_Titin_M1-like	33556..33645	CDD:409521	10/88 (11%)
Ig strand A	33557..33560	CDD:409521	0/2 (0%)
Ig strand A'	33563..33566	CDD:409521	0/2 (0%)
Ig strand B	33570..33579	CDD:409521	1/8 (13%)
Ig strand C	33585..33591	CDD:409521	1/5 (20%)
Ig strand C'	33593..33596	CDD:409521	0/2 (0%)
Ig strand D	33602..33607	CDD:409521	0/4 (0%)
Ig strand E	33611..33617	CDD:409521	1/5 (20%)
Ig strand F	33624..33632	CDD:409521	2/7 (29%)
Ig strand G	33635..33644	CDD:409521	1/8 (13%)
I-set	33676..33768	CDD:400151	23/125 (18%)
Ig strand B	33693..33697	CDD:409543	0/3 (0%)
Ig strand C	33706..33710	CDD:409543	1/3 (33%)
Ig strand E	33734..33738	CDD:409543	0/3 (0%)
Ig strand F	33748..33753	CDD:409543	1/4 (25%)
Ig strand G	33761..33764	CDD:409543	1/2 (50%)
I-set	33781..33871	CDD:400151	12/94 (13%)
Ig strand B	33798..33802	CDD:409353	1/3 (33%)
Ig strand C	33811..33815	CDD:409353	0/3 (0%)
Ig strand E	33837..33841	CDD:409353	0/3 (0%)
Ig strand F	33851..33856	CDD:409353	1/4 (25%)
Ig strand G	33864..33867	CDD:409353	0/2 (0%)
Ig	34361..34450	CDD:472250
Ig strand B	34378..34382	CDD:409543
Ig strand C	34391..34395	CDD:409543
Ig strand E	34416..34420	CDD:409543
Ig strand F	34430..34435	CDD:409543
Ig strand G	34443..34446	CDD:409543
PTZ00121	<34455..35189	CDD:173412
IgI_Titin_like	34545..34636	CDD:143224
Ig strand A	34547..34554	CDD:143224
Ig strand A'	34555..34560	CDD:143224
Ig strand B	34565..34573	CDD:143224
Ig strand C	34577..34583	CDD:143224
Ig strand C'	34585..34587	CDD:143224
Ig strand D	34593..34599	CDD:143224
Ig strand E	34602..34608	CDD:143224
Ig strand F	34617..34624	CDD:143224
Ig strand G	34627..34636	CDD:143224
Ig	34705..34794	CDD:472250
Ig strand B	34720..34724	CDD:409353
Ig strand C	34735..34739	CDD:409353
Ig strand E	34761..34765	CDD:409353
Ig strand F	34775..34780	CDD:409353
I-set	34891..34980	CDD:400151
Ig strand B	34908..34912	CDD:409353
Ig strand C	34921..34925	CDD:409353
Ig strand E	34946..34950	CDD:409353
Ig strand F	34960..34965	CDD:409353
Ig strand G	34973..34976	CDD:409353
I-set	35173..35262	CDD:400151
Ig strand B	35190..35194	CDD:409543
Ig strand C	35203..35207	CDD:409543
Ig strand E	35228..35232	CDD:409543
Ig strand F	35242..35247	CDD:409543
Ig strand G	35255..35258	CDD:409543
I-set	35368..35460	CDD:400151
Ig strand B	35385..35389	CDD:409406
Ig strand C	35398..35402	CDD:409406
Ig strand E	35426..35430	CDD:409406
Ig strand F	35440..35445	CDD:409406
Ig strand G	35453..35456	CDD:409406
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.

DRSC/TRiP Functional Genomics Resources

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Drak and Ttn

DIOPT Version :10

Known Domains:

Indicated by green bases in alignment.