DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and Stk17b

DIOPT Version :9

Sequence 1:NP_001162723.1 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_596883.1 Gene:Stk17b / 170904 RGDID:620457 Length:371 Species:Rattus norvegicus


Alignment Length:345 Identity:130/345 - (37%)
Similarity:198/345 - (57%) Gaps:29/345 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DADRLKGLLVSCP-------DINEIYEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQ 75
            |...:.|||.:.|       :.|..|.:......|||||.||:.|.|:||..:||||||:|||.|
  Rat     7 DCRSISGLLTTTPQTPMKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQ 71

  Fly    76 SSDKEIKHEIAVLMLCEGEDNIVNLNAVHETRSDTALLLELATGGELQTILDNE--ECLTEAQAR 138
            ....||.||||||.|.....:::||:.|:||.::..|:||.|.|||:..:...|  |.::|....
  Rat    72 DCRAEILHEIAVLELARSCPHVINLHEVYETATEIILVLEYAAGGEIFNLCLPELAEMVSENDVI 136

  Fly   139 HCMREVLKALKFLHDRSIAHLDLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDY 203
            ..::::|:.:.:||..:|.|||||||||||:.......:|:.|||:||.:.....:||:.|||:|
  Rat   137 RLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEY 201

  Fly   204 VAPEVLQYEPLSLLTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVA 268
            :|||:|.|:|::..||:|::|::.|:||:..|||.|:..|||:|||||..:.:.:.:|..||.:|
  Rat   202 LAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLA 266

  Fly   269 IDFIRRALRIKPNDRMNATGCLDHIWLK--DDCSLDRQIYLQPQSDAEEEEEEDV---------- 321
            .|||:..|...|..|..|..||.|.||:  |..||     ..|:..:|..:.:|:          
  Rat   267 TDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGSL-----FHPEETSESSQTQDLSLRSSEDKTP 326

  Fly   322 ---DDDVEDEEEEEQVEEEE 338
               :....|.|::|.:.|::
  Rat   327 KSCNGSCGDREDKENIPEDD 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_001162723.1 STKc_DRAK 28..295 CDD:271008 114/275 (41%)
S_TKc 45..295 CDD:214567 111/251 (44%)
PHA03255 379..>554 CDD:165513
Stk17bNP_596883.1 STKc_DRAK2 24..293 CDD:271100 113/268 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..345 5/36 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2415
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31231
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004726
OrthoInspector 1 1.000 - - otm44921
orthoMCL 1 0.900 - - OOG6_106249
Panther 1 1.100 - - O PTHR24342
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3322
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.