DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and Dapk3

DIOPT Version :9

Sequence 1:NP_001162723.1 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001177403.2 Gene:Dapk3 / 13144 MGIID:1203520 Length:465 Species:Mus musculus


Alignment Length:275 Identity:119/275 - (43%)
Similarity:167/275 - (60%) Gaps:15/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DINEIYEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQS----SDKEIKHEIAVLMLC 91
            |:.:.||:.: ....|:||.||:...|.||..:||||:|:||...|    |.:||:.|:::|...
Mouse    25 DVEDHYEMGE-ELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREI 88

  Fly    92 EGEDNIVNLNAVHETRSDTALLLELATGGELQTILDNEECLTEAQARHCMREVLKALKFLHDRSI 156
            . ..||:.|:.|.|.::|..|:|||.:||||...|..:|.|||.:|...::::|..:.:||.:.|
Mouse    89 R-HPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRI 152

  Fly   157 AHLDLKPQNILL-----AGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSL 216
            ||.||||:||:|     |..||    ||.||||:..:..|...:.:.|||::||||::.||||.|
Mouse   153 AHFDLKPENIMLLDKHAASPRI----KLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGL 213

  Fly   217 LTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPN 281
            ..|:||:||:||:||||.|||.|:|||||..|||.....|.:..|...|.:|.|||||.|...|.
Mouse   214 EADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPK 278

  Fly   282 DRMNATGCLDHIWLK 296
            .||.....|:|.|:|
Mouse   279 RRMTIAQSLEHSWIK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_001162723.1 STKc_DRAK 28..295 CDD:271008 117/272 (43%)
S_TKc 45..295 CDD:214567 114/258 (44%)
PHA03255 379..>554 CDD:165513
Dapk3NP_001177403.2 STKc_DAPK 24..292 CDD:271007 117/272 (43%)
S_TKc 30..292 CDD:214567 116/267 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 222 1.000 Domainoid score I2576
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42858
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.