DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drak and Mylk

DIOPT Version :10

Sequence 1:NP_996411.2 Gene:Drak / 32097 FlyBaseID:FBgn0052666 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_647461.3 Gene:Mylk / 107589 MGIID:894806 Length:1950 Species:Mus musculus


Alignment Length:398 Identity:122/398 - (30%)
Similarity:199/398 - (50%) Gaps:53/398 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 INEIYEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKEIKHEIAVLMLCEGEDN 96
            ::::|::|:. ...|||..|.|.:.|.||..:|.||.| ...|:..| .|:.||:: |.|.....
Mouse  1491 VSDVYDIEER-LGSGKFGQVFRLVEKKTGKIWAGKFFK-AYSAKEKD-NIRQEISI-MNCLHHPK 1551

  Fly    97 IVNLNAVHETRSDTALLLELATGGEL-QTILDNEECLTEAQARHCMREVLKALKFLHDRSIAHLD 160
            :|......|.:::..::||:.:|||| :.|:|.:..|||.:....||::.:.::::|.:.|.|||
Mouse  1552 LVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLD 1616

  Fly   161 LKPQNILL---AGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWS 222
            |||:||:.   .|.||    ||.|||::|.:....:::.:.|||::|||||:.|||:...||:||
Mouse  1617 LKPENIMCVNKTGTRI----KLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWS 1677

  Fly   223 VGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNAT 287
            :||:.|:|:||.|||.||...||..|::.....|.|..|..:|..|.|||...|:....:|::.|
Mouse  1678 IGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCT 1742

  Fly   288 GCLDHIWLKDDCSLDRQIYLQPQSDAEEEEEEDVDDDVEDEEEEEQVEEEEEETQNVEEPTTEAP 352
            .||.|.||              ..|.:..|.:.:.   :|..::.....:.::|.|.        
Mouse  1743 QCLQHPWL--------------MKDTKNMEAKKLS---KDRMKKYMARRKWQKTGNA-------- 1782

  Fly   353 QQQQQPVQQHQLAKSGQIHSKPTHNG-HHRANSGGSISKIPIATSKLQSTPSSETTTAIHTLTSN 416
                       :...|::.|....:| ..|.:|.||.:. ||...||:|  ..:.:.|.....:.
Mouse  1783 -----------VRAIGRLSSMAMISGLSGRKSSTGSPTS-PINAEKLES--EDDVSQAFLEAVAE 1833

  Fly   417 SNGHVHKP 424
            ...|| ||
Mouse  1834 EKPHV-KP 1840

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrakNP_996411.2 STKc_DRAK 28..295 CDD:271008 98/266 (37%)
PHA03255 379..>554 CDD:165513 14/46 (30%)
MylkNP_647461.3 I-set 42..132 CDD:400151
Ig strand B 59..63 CDD:409353
Ig strand C 72..76 CDD:409353
Ig strand E 98..102 CDD:409353
Ig strand F 112..117 CDD:409353
Ig strand G 125..128 CDD:409353
I-set 165..254 CDD:400151
Ig strand B 182..186 CDD:409353
Ig strand C 195..199 CDD:409353
Ig strand E 220..224 CDD:409353
Ig strand F 234..239 CDD:409353
Ig strand G 247..250 CDD:409353
23ISL 255..409 CDD:435470
I-set 411..501 CDD:400151
Ig strand B 428..432 CDD:409353
Ig strand C 441..445 CDD:409353
Ig strand E 467..471 CDD:409353
Ig strand F 481..486 CDD:409353
Ig strand G 494..497 CDD:409353
IgI_4_MYLK-like 510..597 CDD:409568
Ig strand A 510..513 CDD:409568
Ig strand A' 519..522 CDD:409568
Ig strand B 527..535 CDD:409568
Ig strand C 541..545 CDD:409568
Ig strand C' 548..551 CDD:409568
Ig strand D 555..559 CDD:409568
Ig strand E 563..568 CDD:409568
Ig strand F 576..584 CDD:409568
Ig strand G 587..597 CDD:409568
Ig 620..709 CDD:472250
Ig strand B 637..641 CDD:409353
Ig strand C 650..654 CDD:409353
Ig strand E 675..679 CDD:409353
Ig strand F 689..694 CDD:409353
Ig strand G 702..705 CDD:409353
I-set 718..806 CDD:400151
Ig strand B 735..739 CDD:409353
Ig strand C 748..752 CDD:409353
Ig strand E 774..778 CDD:409353
Ig strand F 788..793 CDD:409353
Ig strand G 801..804 CDD:409353
I-set 1129..1218 CDD:400151
Ig strand B 1146..1150 CDD:409353
Ig strand C 1159..1163 CDD:409353
Ig strand E 1184..1188 CDD:409353
Ig strand F 1198..1203 CDD:409353
Ig strand G 1211..1214 CDD:409353
IgI_8_hMLCK_like 1268..1366 CDD:409419
Ig strand A 1268..1272 CDD:409419
Ig strand A' 1277..1281 CDD:409419
Ig strand B 1285..1294 CDD:409419
Ig strand C 1298..1304 CDD:409419
Ig strand C' 1307..1309 CDD:409419
Ig strand D 1315..1320 CDD:409419
Ig strand E 1324..1329 CDD:409419
Ig strand F 1337..1345 CDD:409419
Ig strand G 1348..1358 CDD:409419
FN3 1362..1453 CDD:238020
STKc_MLCK1 1492..1750 CDD:271093 98/265 (37%)
IgI_telokin-like 1843..1930 CDD:409565
Ig strand A 1843..1846 CDD:409565
Ig strand A' 1848..1851 CDD:409565
Ig strand B 1855..1864 CDD:409565
Ig strand C 1869..1875 CDD:409565
Ig strand C' 1878..1880 CDD:409565
Ig strand D 1886..1891 CDD:409565
Ig strand E 1894..1902 CDD:409565
Ig strand F 1910..1917 CDD:409565
Ig strand G 1920..1930 CDD:409565
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.