DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and UBA3

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_003959.3 Gene:UBA3 / 9039 HGNCID:12470 Length:463 Species:Homo sapiens


Alignment Length:218 Identity:56/218 - (25%)
Similarity:88/218 - (40%) Gaps:56/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFIN 139
            |.::|.||:|......|...|..::.:.|.|.::::|:||.| |.|...|..|...||   .|:|
Human    72 VLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAA---EFLN 133

  Fly   140 PDVEIETHNYNITTVENFDR---FLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLN 201
            ..|.      |...|.:|::   |.||..       :...:::..:|:..||..||...... ||
Human   134 DRVP------NCNVVPHFNKIQDFNDTFY-------RQFHIIVCGLDSIIARRWINGMLISL-LN 184

  Fly   202 WFESGVSE------------NAVSGHIQFIRPGDTACFACA----PPLVVAENIDEKTLKREGVC 250
             :|.||.:            ....|:.:.|.||.|||..|.    ||.|   |....|:      
Human   185 -YEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQV---NFPMCTI------ 239

  Fly   251 AASLPTTMGITAGFLVQNALKYL 273
             ||:|.        |.::.::|:
Human   240 -ASMPR--------LPEHCIEYV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 56/218 (26%)
ThiF 53..310 CDD:279270 56/218 (26%)
UBA3NP_003959.3 Interaction with UBE2M N-terminus 53..70
Uba3_RUB 71..368 CDD:238765 56/218 (26%)
Interaction with UBE2M N-terminus 157..161 0/3 (0%)
Interaction with UBE2M N-terminus 192..217 3/24 (13%)
Interaction with NEDD8 227..229 0/1 (0%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 242..248 2/13 (15%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 292..295
Interaction with UBE2M N-terminus 331..338
Interaction with NEDD8 352..357
Interaction with UBE2M core domain 368..463
E2_bind 376..461 CDD:400951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.