DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and NAE1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001273429.1 Gene:NAE1 / 8883 HGNCID:621 Length:537 Species:Homo sapiens


Alignment Length:223 Identity:43/223 - (19%)
Similarity:74/223 - (33%) Gaps:64/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DELQAIIADLKTELETE--PKSSGGVASNSR-------------LARDRIDRMSAE--------- 46
            :..:..|.::.|.|.|.  |.|...:.::.|             |||...:.::.|         
Human   266 ENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRG 330

  Fly    47 -----VVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYD 106
                 :.||..|.:|..:.|....||             ...||:..|.:|...|.....:.: .
Human   331 TIPDMIADSGKYIKLQNVYREKAKKD-------------AAAVGNHVAKLLQSIGQAPESISE-K 381

  Fly   107 KVELANMNRLFF-------TPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTI 164
            :::|...|..|.       ..::.||..:.......|..|||.||..: ..:..|:.|.:     
Human   382 ELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLY-LMLRAVDRFHK----- 440

  Fly   165 SQGGRIAG-------QPVDLVLSCVDNF 185
             |.||..|       :.:..:.||:..|
Human   441 -QQGRYPGVSNYQVEEDIGKLKSCLTGF 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 30/148 (20%)
ThiF 53..310 CDD:279270 30/147 (20%)
NAE1NP_001273429.1 ThiF 9..>196 CDD:223552
APPBP1_RUB 11..535 CDD:238770 43/223 (19%)
Interaction with UBA3 334..347 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.